| Clone Name | rbags22g15 |
|---|---|
| Clone Library Name | barley_pub |
>PTTG_MOUSE (Q8R143) Pituitary tumor-transforming gene 1 protein-interacting| protein precursor (Pituitary tumor-transforming gene protein-binding factor) (PTTG-binding factor) (PBF) Length = 174 Score = 31.2 bits (69), Expect(2) = 0.64 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -2 Query: 172 RW-ICWFQFQAVDVTYSLFAFICLFVMRVCSIFLCMR 65 RW +CW F+A+ +T S+ L + VC + C R Sbjct: 84 RWGVCWVNFEALIITMSVLGGSVLLGITVCCCYCCRR 120 Score = 20.8 bits (42), Expect(2) = 0.64 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -3 Query: 258 PRIMCNASGRRPASECVLKVS 196 PR+ C+ R EC+ VS Sbjct: 33 PRVGCSEYTNRSCEECLRNVS 53
>UDB31_CANFA (Q6K1J1) UDP-glucuronosyltransferase 2B31 precursor (EC 2.4.1.17)| (UDPGT) Length = 530 Score = 32.7 bits (73), Expect = 0.85 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = -2 Query: 190 HARPLVRWICWFQFQAVDVTYSLFAFI--CLFVMRVCSIFLCMR 65 H RP + WFQ+ ++DV L A + +FV C +F C + Sbjct: 476 HLRPASHDLTWFQYHSLDVIGFLLACVATAIFVTTQCCLFCCRK 519
>UDB9_MACFA (O02663) UDP-glucuronosyltransferase 2B9 precursor (EC 2.4.1.17)| (UDPGT) Length = 529 Score = 30.8 bits (68), Expect = 3.2 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = -2 Query: 190 HARPLVRWICWFQFQAVDVTYSLFAFIC--LFVMRVCSIF 77 H RP + WFQ+ ++DV L A + +FV+ C +F Sbjct: 475 HLRPAAHDLTWFQYHSLDVIGFLLACVATVIFVIMKCCLF 514
>UDB33_MACMU (Q9GLD9) UDP-glucuronosyltransferase 2B33 precursor (EC 2.4.1.17)| (UDPGT) Length = 529 Score = 30.4 bits (67), Expect = 4.2 Identities = 13/40 (32%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = -2 Query: 190 HARPLVRWICWFQFQAVDVTYSLFAFIC--LFVMRVCSIF 77 H RP + WFQ+ ++DV L A + +F++ C +F Sbjct: 475 HLRPAAHDLTWFQYHSLDVIGFLLACVATVIFIIMKCCLF 514
>UDB18_MACFA (O97951) UDP-glucuronosyltransferase 2B18 precursor (EC 2.4.1.17)| (UDPGT) Length = 529 Score = 30.4 bits (67), Expect = 4.2 Identities = 13/40 (32%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = -2 Query: 190 HARPLVRWICWFQFQAVDVTYSLFAFIC--LFVMRVCSIF 77 H RP + WFQ+ ++DV L A + +F++ C +F Sbjct: 475 HLRPAAHDLTWFQYHSLDVIGFLLACVATVIFIIMKCCLF 514
>GNRR2_HUMAN (Q96P88) Gonadotropin-releasing hormone II receptor (Type II GnRH| receptor) (GnRH-II-R) Length = 379 Score = 30.0 bits (66), Expect = 5.5 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = -2 Query: 157 FQFQAVDVTYSLFAFICLFVMRVCSIFLC 71 F+ Q + TY+LF F CLF++ + ++ +C Sbjct: 194 FKAQWQETTYNLFTFCCLFLLPLTAMAIC 222
>UDB23_MACFA (Q9TSL6) UDP-glucuronosyltransferase 2B23 precursor (EC 2.4.1.17)| (UDPGT) Length = 529 Score = 29.6 bits (65), Expect = 7.2 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -2 Query: 190 HARPLVRWICWFQFQAVDVTYSLFAFIC--LFVMRVCSIF 77 H RP + WFQ+ + DV L A + +F++ C +F Sbjct: 475 HLRPAAHDLTWFQYHSFDVIGFLLACVATVIFIIMKCCLF 514
>PTTG_RAT (Q6P767) Pituitary tumor-transforming gene 1 protein-interacting| protein precursor (Pituitary tumor-transforming gene protein-binding factor) (PTTG-binding factor) (PBF) Length = 174 Score = 29.3 bits (64), Expect = 9.4 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -2 Query: 172 RW-ICWFQFQAVDVTYSLFAFICLFVMRVCSIFLCMR 65 RW +CW F+A+ +T S+ L + VC C R Sbjct: 84 RWGVCWVNFEALIITMSVLGGSVLLGITVCCCCCCRR 120 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 83,053,211 Number of Sequences: 219361 Number of extensions: 1651422 Number of successful extensions: 4335 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 4201 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4335 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5424720305 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)