| Clone Name | rbags22f06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YQI4_CAEEL (Q09505) Hypothetical protein C45G9.4 | 30 | 4.9 | 2 | YQI9_CAEEL (Q09507) Hypothetical protein C45G9.9 | 30 | 4.9 |
|---|
>YQI4_CAEEL (Q09505) Hypothetical protein C45G9.4| Length = 292 Score = 30.4 bits (67), Expect = 4.9 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +2 Query: 74 SHKWTQQLNVTTRCLTRSWITEQAVAVVEVNKLLHILRDCPNNV 205 SHK+ V C R W+ E +V ++ + + H+LR N + Sbjct: 221 SHKFFMTQYVKDECRVRRWVYEDSVPLMMESNMKHMLRMASNRI 264
>YQI9_CAEEL (Q09507) Hypothetical protein C45G9.9| Length = 294 Score = 30.4 bits (67), Expect = 4.9 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +2 Query: 74 SHKWTQQLNVTTRCLTRSWITEQAVAVVEVNKLLHILRDCPNNV 205 SHK+ V C R W+ E +V ++ + + H+LR N + Sbjct: 223 SHKFFMTQYVKDECRVRRWVYEDSVPLMMESNMKHMLRMASNRI 266 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 94,856,122 Number of Sequences: 219361 Number of extensions: 1929038 Number of successful extensions: 3877 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3790 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3877 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6314008338 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)