| Clone Name | rbags21p23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RHG04_HUMAN (P98171) Rho-GTPase-activating protein 4 (Rho-GAP he... | 31 | 2.5 | 2 | HYAL1_MOUSE (Q91ZJ9) Hyaluronidase-1 precursor (EC 3.2.1.35) (Hy... | 30 | 4.2 | 3 | MGR1_RAT (P23385) Metabotropic glutamate receptor 1 precursor (m... | 29 | 9.4 | 4 | MGR1_MOUSE (P97772) Metabotropic glutamate receptor 1 precursor ... | 29 | 9.4 |
|---|
>RHG04_HUMAN (P98171) Rho-GTPase-activating protein 4 (Rho-GAP hematopoietic| protein C1) (p115) Length = 946 Score = 31.2 bits (69), Expect = 2.5 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +1 Query: 16 CAKVENKYTLSTSKC*TANTNYFSFLVLNLLVCIARGEH 132 C K N+Y LS + A +NY+ VL+L+ C G H Sbjct: 239 CTKARNEYLLSLASVNAAVSNYYLHDVLDLMDCCDTGFH 277
>HYAL1_MOUSE (Q91ZJ9) Hyaluronidase-1 precursor (EC 3.2.1.35) (Hyal-1)| (Hyaluronoglucosaminidase-1) Length = 462 Score = 30.4 bits (67), Expect = 4.2 Identities = 25/82 (30%), Positives = 37/82 (45%), Gaps = 1/82 (1%) Frame = +1 Query: 73 TNYFSFLVLNLLVCIARGEHSFGHNLGT*VWRHQLPT-PDSDPYQHPEAAGLESTTGITT 249 T Y + +++ +A E SF + T +R +L T P P P GL Sbjct: 73 TEYGVDVDVSVFDVVANKEQSFQGSNMTIFYREELGTYPYYTPTGEPVFGGLPQNAS--- 129 Query: 250 LQVLATHLAHSFKDMA*ALQWP 315 L THLAH+F+D+ A+ P Sbjct: 130 ---LVTHLAHTFQDIKAAMPEP 148
>MGR1_RAT (P23385) Metabotropic glutamate receptor 1 precursor (mGluR1)| Length = 1199 Score = 29.3 bits (64), Expect = 9.4 Identities = 21/80 (26%), Positives = 34/80 (42%) Frame = -2 Query: 583 NSSSRNRPDIHPSKEMNPTKMNLSQTMSLHEKQPQQNTYISPQTVTVRLMQVSYSVGRKS 404 NS+ ++ P P ++ Q +S+H K N QT ++ + SY KS Sbjct: 887 NSNGKSVSWSEPGGRQAPKGQHVWQRLSVHVKT---NETACNQTAVIKPLTKSYQGSGKS 943 Query: 403 LGYMTWRTGALYELHGGDHT 344 L + T LY + D+T Sbjct: 944 LTFSDASTKTLYNVEEEDNT 963
>MGR1_MOUSE (P97772) Metabotropic glutamate receptor 1 precursor (mGluR1)| Length = 1199 Score = 29.3 bits (64), Expect = 9.4 Identities = 21/80 (26%), Positives = 34/80 (42%) Frame = -2 Query: 583 NSSSRNRPDIHPSKEMNPTKMNLSQTMSLHEKQPQQNTYISPQTVTVRLMQVSYSVGRKS 404 NS+ ++ P P ++ Q +S+H K N QT ++ + SY KS Sbjct: 887 NSNGKSVSWSEPGGRQAPKGQHVWQRLSVHVKT---NETACNQTAVIKPLTKSYQGSGKS 943 Query: 403 LGYMTWRTGALYELHGGDHT 344 L + T LY + D+T Sbjct: 944 LTFSDASTKTLYNVEEEDNT 963 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 78,814,434 Number of Sequences: 219361 Number of extensions: 1533842 Number of successful extensions: 3957 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3821 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3956 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5424720305 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)