>SCNAA_XENLA (P51167) Amiloride-sensitive sodium channel alpha-subunit|
           (Epithelial Na+ channel alpha subunit) (Alpha ENaC)
           (Nonvoltage-gated sodium channel 1 alpha subunit)
           (SCNEA) (Alpha NaCH)
          Length = 632

 Score = 29.6 bits (65), Expect = 7.0
 Identities = 14/38 (36%), Positives = 19/38 (50%)
 Frame = +3

Query: 177 MMIVRRQQEKKEELGEPNYLTRFPAPAFGDRSFMNPHV 290
           M+++ R   KK   GE   +   PAPAF D     PH+
Sbjct: 540 MILLHRYYYKKANEGEETTVVPTPAPAFADLEQQVPHI 577


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 69,361,361
Number of Sequences: 219361
Number of extensions: 1132098
Number of successful extensions: 2887
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2750
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2887
length of database: 80,573,946
effective HSP length: 107
effective length of database: 57,102,319
effective search space used: 5310515667
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)