| Clone Name | rbags22d14 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | COQ5_RAT (Q4G064) Ubiquinone biosynthesis methyltransferase COQ5... | 30 | 6.3 | 2 | HEAD_BPAPS (Q9T1S4) Major head protein (p24) (Major coat protein) | 30 | 8.2 | 3 | FABH_RHIME (Q92QT4) 3-oxoacyl-[acyl-carrier-protein] synthase 3 ... | 30 | 8.2 |
|---|
>COQ5_RAT (Q4G064) Ubiquinone biosynthesis methyltransferase COQ5,| mitochondrial precursor (EC 2.1.1.-) Length = 327 Score = 30.0 bits (66), Expect = 6.3 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +1 Query: 367 KSCCLREWVFHGWVQAIGVCRLIGNRR 447 +SC L + HGW + G CRL G RR Sbjct: 5 RSCVLWSYCGHGWSRLAGDCRLPGFRR 31
>HEAD_BPAPS (Q9T1S4) Major head protein (p24) (Major coat protein)| Length = 422 Score = 29.6 bits (65), Expect = 8.2 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -1 Query: 573 ISFCSTHWINQLMAVTTGDGATQSTFEAS 487 + F STHW+NQ T +G+T +F A+ Sbjct: 267 LKFTSTHWLNQQSKQTLYNGSTAMSFTAT 295
>FABH_RHIME (Q92QT4) 3-oxoacyl-[acyl-carrier-protein] synthase 3 (EC 2.3.1.41)| (3-oxoacyl-[acyl-carrier-protein] synthase III) (Beta-ketoacyl-ACP synthase III) (KAS III) Length = 323 Score = 29.6 bits (65), Expect = 8.2 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 551 QWVLQKLIVWHRQIIGEGSTSQIIGEGFTR 640 +W++Q+ + R I GEG TS +GE R Sbjct: 32 EWIVQRTGIRQRYIAGEGETSASLGEAAAR 61 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,693,576 Number of Sequences: 219361 Number of extensions: 1925948 Number of successful extensions: 5505 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5282 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5500 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6200242422 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)