| Clone Name | rbaal0e07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MDN1_GIALA (Q8T5T1) Midasin (MIDAS-containing protein) | 29 | 7.3 | 2 | GTHB1_ICTPU (Q9DG81) Gonadotropin beta-1 subunit precursor (Gona... | 29 | 7.3 | 3 | NO12B_MEDSA (Q40339) Early nodulin 12B precursor (N-12B) | 28 | 9.6 |
|---|
>MDN1_GIALA (Q8T5T1) Midasin (MIDAS-containing protein)| Length = 4835 Score = 28.9 bits (63), Expect = 7.3 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = +1 Query: 7 TQXRLNCDRMTLALQSDPFQTSRDEIILPWNHPTRISQKIQTPPTKRPP 153 TQ RL C R++L P + S D+I NH TR+ + I + P Sbjct: 304 TQKRLVCGRVSLPFYESPDERSLDDICRT-NHTTRLLEIISSAIRNNEP 351
>GTHB1_ICTPU (Q9DG81) Gonadotropin beta-1 subunit precursor (Gonadotropin| beta-I chain) (GTH-I-beta) (GTH beta-1) Length = 132 Score = 28.9 bits (63), Expect = 7.3 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = -3 Query: 86 IISSLLVWNGSDCKAKVILSQLSL 15 ++ +LVW GS+CKA+ L+ +S+ Sbjct: 9 LLLPMLVWAGSECKARCCLTNISI 32
>NO12B_MEDSA (Q40339) Early nodulin 12B precursor (N-12B)| Length = 113 Score = 28.5 bits (62), Expect = 9.6 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +1 Query: 91 PWNHPTRISQKIQTPPTKRPPHNQHLPA 174 P N P + + PP K PP ++H PA Sbjct: 80 PVNKPPQKESPVHKPPRKEPPTHKHPPA 107 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,250,227 Number of Sequences: 219361 Number of extensions: 741767 Number of successful extensions: 2635 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2496 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2632 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)