| Clone Name | rbags22a13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SUREJ_STRPU (Q26627) Sperm receptor for egg jelly precursor (suREJ) | 30 | 2.9 | 2 | HYD_DROME (P51592) Ubiquitin--protein ligase hyd (EC 6.3.2.-) (P... | 29 | 6.4 |
|---|
>SUREJ_STRPU (Q26627) Sperm receptor for egg jelly precursor (suREJ)| Length = 1450 Score = 30.0 bits (66), Expect = 2.9 Identities = 17/59 (28%), Positives = 34/59 (57%), Gaps = 2/59 (3%) Frame = -3 Query: 426 WMHS*-TGVCYLLSDLGVLFA-GYEDLLESFSVDQSVHLIYKNVFLVNLIDGDLLLGVN 256 W+H+ TG CY + G +++ G E L++ + S+H +N F+ +++ + LG+N Sbjct: 205 WVHNPATGYCYFYEERGGMWSKGREFCLDAGADLASIHSAEENAFIFDMLTEFVWLGLN 263
>HYD_DROME (P51592) Ubiquitin--protein ligase hyd (EC 6.3.2.-) (Protein| hyperplastic discs) Length = 2885 Score = 28.9 bits (63), Expect = 6.4 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +3 Query: 201 WFDLTVLNHLTISSVTFKSLLQGANL 278 WFDL + +T+S+++ ++L G NL Sbjct: 869 WFDLPPVKSITMSTISLPAMLSGVNL 894 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,500,674 Number of Sequences: 219361 Number of extensions: 1142785 Number of successful extensions: 2250 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2224 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2250 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)