| Clone Name | rbags22a10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PITX3_HUMAN (O75364) Pituitary homeobox 3 (Homeobox protein PITX3) | 29 | 9.6 |
|---|
>PITX3_HUMAN (O75364) Pituitary homeobox 3 (Homeobox protein PITX3)| Length = 302 Score = 28.9 bits (63), Expect = 9.6 Identities = 17/51 (33%), Positives = 22/51 (43%) Frame = +1 Query: 193 SCTHIMKGCGR*LMASSPQVYRLPVHGWWPTAFPKLSLVALFHFPSPHCPP 345 SC + ASSP VYR P + + K A F +P+ H PP Sbjct: 236 SCPYASAAAAAAAAASSPYVYRDPCNSSLASLRLKAKQHASFSYPAVHGPP 286 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 81,766,161 Number of Sequences: 219361 Number of extensions: 1675845 Number of successful extensions: 3404 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3272 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3402 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4258037034 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)