| Clone Name | rbags21j12 |
|---|---|
| Clone Library Name | barley_pub |
>JMT_BRARP (Q9SBK6) Jasmonate O-methyltransferase (EC 2.1.1.141)| (S-adenosyl-L-methionine:jasmonic acid carboxyl methyltransferase) (Floral nectary-specific protein 1) Length = 392 Score = 32.0 bits (71), Expect = 1.6 Identities = 26/77 (33%), Positives = 34/77 (44%), Gaps = 6/77 (7%) Frame = +1 Query: 127 KIFRWESQNKG*AEKCYAKNSCFQS------RRCSPKALVYQFVHEADLLKTGFIALSSS 288 ++ R NKG E YAKNS QS RR +AL + +++L G L S Sbjct: 2 EVMRILHMNKGNGETSYAKNSIVQSNIISLGRRVMDEALKKLMIRNSEILSFGIADLGCS 61 Query: 289 KAIIPRCEGSSSNILAT 339 P S SNI+ T Sbjct: 62 SG--PNSLLSISNIVET 76
>RL23_TRYCR (Q94776) 60S ribosomal protein L23 (L17) (TCEST082)| Length = 141 Score = 31.2 bits (69), Expect = 2.7 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 5/61 (8%) Frame = -3 Query: 512 LTAASIKTGRPQIARR---AIDLAERRLL--KDGWPEYYDGKLGKYVGKQARKFQTWSIA 348 + AS+K G+P++ R+ A+ + +R+ KDG Y++ G V Q R + IA Sbjct: 59 IVMASVKKGKPELRRKVLNAVIIRQRKSWRRKDGTVIYFEDNAGVIVNSQGRDGRVSGIA 118 Query: 347 G 345 G Sbjct: 119 G 119
>LPHN1_MOUSE (Q80TR1) Latrophilin-1 (Calcium-independent alpha-latrotoxin receptor| 1) (Lectomedin-2) (Fragment) Length = 1406 Score = 29.6 bits (65), Expect = 7.9 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = -2 Query: 288 GRGQGNEASFEKVRLMDKLIHKSFRGATSGLK 193 GR + A+FEK+ ++ +L+H + RGA+ G K Sbjct: 1205 GRNLADAAAFEKM-IISELVHNNLRGASGGAK 1235
>DPOLQ_HUMAN (O75417) DNA polymerase theta (EC 2.7.7.7) (DNA polymerase eta)| Length = 1762 Score = 29.6 bits (65), Expect = 7.9 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +3 Query: 33 KRKENTHFHNCFFSNSINELRYCTAEEFRRK*NFPLGKSKQGMSR 167 K +E+T NC F N E + C+ R++ + + K K G S+ Sbjct: 133 KSREHTSSFNCNFQNGNQEHQTCSIFRARKRASLDINKEKPGASQ 177
>LPHN1_RAT (O88917) Latrophilin-1 precursor (Calcium-independent| alpha-latrotoxin receptor 1) (CIRL-1) Length = 1515 Score = 29.6 bits (65), Expect = 7.9 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = -2 Query: 288 GRGQGNEASFEKVRLMDKLIHKSFRGATSGLK 193 GR + A+FEK+ ++ +L+H + RGA+ G K Sbjct: 1314 GRNLADAAAFEKM-IISELVHNNLRGASGGAK 1344 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 100,035,886 Number of Sequences: 219361 Number of extensions: 2166494 Number of successful extensions: 6288 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6089 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6287 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 5972710590 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)