| Clone Name | rbaal0c09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SPY_DROME (O44783) Protein sprouty (Spry) | 28 | 7.3 | 2 | Y610_ENCCU (Q8SVF2) Hypothetical protein ECU06_0100 | 27 | 9.5 | 3 | RLF_HUMAN (Q13129) Zinc finger protein Rlf (Rearranged L-myc fus... | 27 | 9.5 |
|---|
>SPY_DROME (O44783) Protein sprouty (Spry)| Length = 589 Score = 27.7 bits (60), Expect = 7.3 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -3 Query: 89 CRCRQSQNLESIPSSQ*LRQTCLC 18 CRC Q Q+ +P + +TCLC Sbjct: 384 CRCEQCQSPRPLPQTWVCNKTCLC 407
>Y610_ENCCU (Q8SVF2) Hypothetical protein ECU06_0100| Length = 261 Score = 27.3 bits (59), Expect = 9.5 Identities = 20/77 (25%), Positives = 37/77 (48%), Gaps = 12/77 (15%) Frame = +1 Query: 151 ILVLV*SYTKLETFILRRSEY*SCTENKLHR-------EIAILYTPPDKLQATVYPILV- 306 I++L SY+ LE F+L R+ S ++LH+ + I ++ L ++P+ Sbjct: 61 IMLLPFSYSALECFLLFRNNLESSYRSELHKMPYSIFNVLLIAFSVISILSIAIFPLSTW 120 Query: 307 ----IPXFSPLLPAXII 345 + +S LLP I+ Sbjct: 121 SNNDVSSYSMLLPCLIV 137
>RLF_HUMAN (Q13129) Zinc finger protein Rlf (Rearranged L-myc fusion gene| protein) (Zn-15-related protein) Length = 1914 Score = 27.3 bits (59), Expect = 9.5 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 83 CRQSQNLESIPSSQ*LRQTCLCGHLPN 3 C +S+ + ++ S Q TCLC LPN Sbjct: 238 CAESKEISNVSSFQQAYITCLCSMLPN 264 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,426,851 Number of Sequences: 219361 Number of extensions: 844667 Number of successful extensions: 1679 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1653 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1679 length of database: 80,573,946 effective HSP length: 93 effective length of database: 60,173,373 effective search space used: 1444160952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)