| Clone Name | rbags21e18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ATC2_YEAST (P38929) Calcium-transporting ATPase 2 (EC 3.6.3.8) (... | 28 | 7.2 | 2 | LRRK1_HUMAN (Q38SD2) Leucine-rich repeat serine/threonine-protei... | 28 | 7.2 | 3 | CO4A3_HUMAN (Q01955) Collagen alpha-3(IV) chain precursor (Goodp... | 28 | 7.2 |
|---|
>ATC2_YEAST (P38929) Calcium-transporting ATPase 2 (EC 3.6.3.8) (Vacuolar| Ca(2+)-ATPase) Length = 1173 Score = 27.7 bits (60), Expect = 7.2 Identities = 15/43 (34%), Positives = 26/43 (60%) Frame = +1 Query: 58 ERLPRGHSSRSNSTAYGKPLGSGSSFQLHLLITYI*XFFGPNI 186 +R PRG S+ S + K + S ++ QL ++T+I F+GP + Sbjct: 959 DRKPRGRSTSLISVSTWKMILSQATLQL--IVTFILHFYGPEL 999
>LRRK1_HUMAN (Q38SD2) Leucine-rich repeat serine/threonine-protein kinase 1 (EC| 2.7.11.1) Length = 2038 Score = 27.7 bits (60), Expect = 7.2 Identities = 18/50 (36%), Positives = 22/50 (44%), Gaps = 4/50 (8%) Frame = -2 Query: 328 VCFAEVXGEEPXRXXVVW----QSRSCCARXRMMHDLCLRAACXVPDPFR 191 VC +E GEE VVW ++ S + LC R C VP P R Sbjct: 1763 VCSSEGRGEE-----VVWCLDDKANSLVMYHSTTYQLCARYFCGVPSPLR 1807
>CO4A3_HUMAN (Q01955) Collagen alpha-3(IV) chain precursor (Goodpasture antigen)| Length = 1670 Score = 27.7 bits (60), Expect = 7.2 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +3 Query: 153 NLYLVFFWS*YTSLKGSGTXQAALKQRSCIIRXRAQQLRDCH 278 +L+ F + +TS GT QA SC+ RA +CH Sbjct: 1576 SLWKGFSFIMFTSAGSEGTGQALASPGSCLEEFRASPFLECH 1617 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,415,381 Number of Sequences: 219361 Number of extensions: 772099 Number of successful extensions: 1323 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1306 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1323 length of database: 80,573,946 effective HSP length: 94 effective length of database: 59,954,012 effective search space used: 1438896288 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)