| Clone Name | rbags20p07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NMT1_ARATH (Q9LTR9) Glycylpeptide N-tetradecanoyltransferase 1 (... | 32 | 2.0 | 2 | TOLB_ERWCT (Q6D7F2) Protein tolB precursor | 30 | 4.6 | 3 | IBP3_BOVIN (P20959) Insulin-like growth factor-binding protein 3... | 30 | 6.0 | 4 | CADC_ECOLI (P23890) Transcriptional activator cadC | 30 | 6.0 | 5 | IBP5_XENLA (Q90WV8) Insulin-like growth factor-binding protein 5... | 30 | 7.8 |
|---|
>NMT1_ARATH (Q9LTR9) Glycylpeptide N-tetradecanoyltransferase 1 (EC 2.3.1.97)| (Peptide N-myristoyltransferase 1) (Myristoyl-CoA:protein N-myristoyltransferase 1) (NMT 1) (Type I N-myristoyltransferase 1) Length = 434 Score = 31.6 bits (70), Expect = 2.0 Identities = 21/66 (31%), Positives = 32/66 (48%) Frame = -2 Query: 278 SDFEANPIVDGQWLLPCAVDIDSFLLKGALLVYFSKPNFCLVTNFLVYYCIPNPRRSEPL 99 +DF+ N + WLLP +DS+L++ P VT+F +Y +P+ P Sbjct: 300 TDFDENDVE--HWLLPREDVVDSYLVES--------PETHDVTDFCSFYTLPSTILGNPN 349 Query: 98 QTTLHA 81 TTL A Sbjct: 350 YTTLKA 355
>TOLB_ERWCT (Q6D7F2) Protein tolB precursor| Length = 430 Score = 30.4 bits (67), Expect = 4.6 Identities = 18/50 (36%), Positives = 27/50 (54%) Frame = +2 Query: 137 TPKNWSLDRSLA*KNTQARHLSRGSYLYPLRMVTTTGHPRSGLLQNQTKI 286 TP W+ A Q + + GSYL ++V T+G+P + L QNQ K+ Sbjct: 87 TPAAWTALGIDAVVVGQVQPSADGSYLVSYQLVDTSGNPGNVLAQNQFKV 136
>IBP3_BOVIN (P20959) Insulin-like growth factor-binding protein 3 precursor| (IGFBP-3) (IBP-3) (IGF-binding protein 3) Length = 291 Score = 30.0 bits (66), Expect = 6.0 Identities = 17/45 (37%), Positives = 20/45 (44%), Gaps = 6/45 (13%) Frame = -2 Query: 131 CIPNPRRSEPLQTTLHARGLCCT------IKPELFPVFSVNSRDS 15 C P P PLQ L RGLC ++P L P S N +S Sbjct: 96 CQPPPGDPRPLQALLDGRGLCANASAVGRLRPYLLPSASGNGSES 140
>CADC_ECOLI (P23890) Transcriptional activator cadC| Length = 512 Score = 30.0 bits (66), Expect = 6.0 Identities = 10/30 (33%), Positives = 20/30 (66%) Frame = -3 Query: 631 SSAPVVSRIMQNQKGSCFWIWFLFLTSLGL 542 ++ P +++++ + FW+WF FL SLG+ Sbjct: 142 TATPPEQSPVKSKRFTTFWVWFFFLLSLGI 171
>IBP5_XENLA (Q90WV8) Insulin-like growth factor-binding protein 5 precursor| (IGFBP-5) (IBP-5) (IGF-binding protein 5) (xIGFBP-5) Length = 265 Score = 29.6 bits (65), Expect = 7.8 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -2 Query: 131 CIPNPRRSEPLQTTLHARGLCCTIK 57 C+P +PL LH RG+C +K Sbjct: 81 CLPEQGEEKPLHALLHGRGVCLNLK 105 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 98,053,993 Number of Sequences: 219361 Number of extensions: 2125950 Number of successful extensions: 4380 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4295 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4380 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5881538857 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)