ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbags21e11 |
|---|---|
| Clone Library Name | barley_pub |
>RNZ1_MOUSE (Q8VEB6) Zinc phosphodiesterase ELAC protein 1 (EC 3.1.26.11)| (Ribonuclease Z 1) (RNase Z 1) (tRNase Z 1) (tRNA 3 endonuclease 1) (ElaC homolog protein 1) Length = 362 Score = 32.0 bits (71), Expect = 1.3 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 336 PTSKATCIILLCQVECHDFDCSNGART 416 PT A+ ++L C+ EC FDC G +T Sbjct: 17 PTRGASAVVLRCEGECWLFDCGEGTQT 43
>RNZ1_HUMAN (Q9H777) Zinc phosphodiesterase ELAC protein 1 (EC 3.1.26.11)| (Ribonuclease Z 1) (RNase Z 1) (tRNase Z 1) (tRNA 3 endonuclease 1) (ElaC homolog protein 1) (Deleted in Ma29) Length = 363 Score = 32.0 bits (71), Expect = 1.3 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 336 PTSKATCIILLCQVECHDFDCSNGART 416 PT A+ ++L C+ EC FDC G +T Sbjct: 17 PTRGASAVVLRCEGECWLFDCGEGTQT 43
>HSPB8_MOUSE (Q9JK92) Heat-shock protein beta-8 (HspB8) (Alpha crystallin C| chain) (Small stress protein-like protein HSP22) Length = 196 Score = 30.4 bits (67), Expect = 3.9 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = -2 Query: 556 GRLIVTGEPEQLDNPWGVTP--FKKVISLPSRIDPHQTSAVVTLHGQLFVRAP 404 G + V+G+ E+ G+ F K I LP+ +DP A ++ G L + AP Sbjct: 117 GYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPATVFASLSPEGLLIIEAP 169
>HSPB8_MACMU (Q6SJQ8) Heat-shock protein beta-8 (HspB8) (Protein kinase H11)| Length = 195 Score = 30.0 bits (66), Expect = 5.1 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = -2 Query: 556 GRLIVTGEPEQLDNPWGVTP--FKKVISLPSRIDPHQTSAVVTLHGQLFVRAP 404 G + V+G+ E+ G+ F K I LP+ +DP A ++ G L + AP Sbjct: 116 GYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAP 168
>HSPB8_RAT (Q9EPX0) Heat-shock protein beta-8 (HspB8) (Alpha crystallin C| chain) (Small stress protein-like protein HSP22) Length = 196 Score = 30.0 bits (66), Expect = 5.1 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = -2 Query: 556 GRLIVTGEPEQLDNPWGVTP--FKKVISLPSRIDPHQTSAVVTLHGQLFVRAP 404 G + V+G+ E+ G+ F K I LP+ +DP A ++ G L + AP Sbjct: 117 GYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAP 169
>HSPB8_PONPY (Q5RAB0) Heat-shock protein beta-8 (HspB8)| Length = 196 Score = 30.0 bits (66), Expect = 5.1 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = -2 Query: 556 GRLIVTGEPEQLDNPWGVTP--FKKVISLPSRIDPHQTSAVVTLHGQLFVRAP 404 G + V+G+ E+ G+ F K I LP+ +DP A ++ G L + AP Sbjct: 117 GYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAP 169
>HSPB8_HUMAN (Q9UJY1) Heat-shock protein beta-8 (HspB8) (Alpha crystallin C| chain) (Small stress protein-like protein HSP22) (E2-induced gene 1 protein) (Protein kinase H11) Length = 196 Score = 30.0 bits (66), Expect = 5.1 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = -2 Query: 556 GRLIVTGEPEQLDNPWGVTP--FKKVISLPSRIDPHQTSAVVTLHGQLFVRAP 404 G + V+G+ E+ G+ F K I LP+ +DP A ++ G L + AP Sbjct: 117 GYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAP 169
>HSPB8_BOVIN (Q5EAC9) Heat-shock protein beta-8 (HspB8)| Length = 196 Score = 30.0 bits (66), Expect = 5.1 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = -2 Query: 556 GRLIVTGEPEQLDNPWGVTP--FKKVISLPSRIDPHQTSAVVTLHGQLFVRAP 404 G + V+G+ E+ G+ F K I LP+ +DP A ++ G L + AP Sbjct: 117 GYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAP 169
>SPS_SOLTU (Q43845) Sucrose-phosphate synthase (EC 2.4.1.14)| (UDP-glucose-fructose-phosphate glucosyltransferase) Length = 1053 Score = 29.6 bits (65), Expect = 6.7 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +3 Query: 318 CKPSYDPTSKATCIILLCQ-VECHDFDCSNGARTNNCP 428 CKP P SK ++ Q + CH C NG+R N P Sbjct: 914 CKPGTVPPSKELRKVMRIQALRCHAVYCQNGSRINVIP 951 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 82,388,204 Number of Sequences: 219361 Number of extensions: 1632412 Number of successful extensions: 3615 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 3450 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3613 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5044307840 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
