| Clone Name | rbags21e08 |
|---|---|
| Clone Library Name | barley_pub |
>TATR_NPVBM (P33245) Trans-activating transcriptional regulatory protein| (Immediate early protein 1) (IE-1) Length = 587 Score = 30.0 bits (66), Expect = 5.7 Identities = 14/51 (27%), Positives = 29/51 (56%) Frame = +2 Query: 65 RRDVLPYNYKSNCNLLVHNIRYNSNTDSEQKSRDLLQRTKLQNSRVNPLEK 217 ++ L Y Y S NLL +N +Y+ N S + + L++ K ++ ++ +E+ Sbjct: 425 KKSTLTYKYSSVANLLFNNYKYHDNIASNNNAEN-LKKVKKEDGSMHIVEQ 474
>TATR_NPVAC (P11138) Trans-activating transcriptional regulatory protein| (Immediate early protein 1) (IE-1) Length = 582 Score = 30.0 bits (66), Expect = 5.7 Identities = 14/51 (27%), Positives = 29/51 (56%) Frame = +2 Query: 65 RRDVLPYNYKSNCNLLVHNIRYNSNTDSEQKSRDLLQRTKLQNSRVNPLEK 217 ++ L Y Y S NLL +N +Y+ N S + + L++ K ++ ++ +E+ Sbjct: 420 KKSTLTYKYSSVANLLFNNYKYHDNIASNNNAEN-LKKVKKEDGSMHIVEQ 469
>KRA13_HUMAN (Q8IUG1) Keratin-associated protein 1-3 (Keratin-associated protein| 1.8) (Keratin-associated protein 1.9) Length = 177 Score = 29.6 bits (65), Expect = 7.4 Identities = 22/70 (31%), Positives = 28/70 (40%) Frame = -2 Query: 419 GYPGAKCKEARCXESF*WQPSRLVQMQVYPSRCQHTLDGNISLQFFFFMCSDVSXTC*QF 240 G G+ C + C E+ QPS PS CQ + G S F S +C Q Sbjct: 18 GTCGSSCCQPSCCETSCCQPSCCETSCCQPSCCQTSFCGFPS----FSTSGTCSSSCCQP 73 Query: 239 ACCPTLFTSP 210 +CC T P Sbjct: 74 SCCETSCCQP 83
>CPR3_ARATH (Q9SUT0) Probable cysteine proteinase At4g11310 precursor (EC| 3.4.22.-) Length = 364 Score = 29.3 bits (64), Expect = 9.7 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 250 HVKLTSEHMKKKNCSEILPSSVCWHREG 333 HV +TS K + ++LP SV W EG Sbjct: 120 HVFMTSSDRYKTSADDVLPKSVDWRNEG 147
>NU5M_ASCSU (P24884) NADH-ubiquinone oxidoreductase chain 5 (EC 1.6.5.3) (NADH| dehydrogenase subunit 5) Length = 547 Score = 29.3 bits (64), Expect = 9.7 Identities = 15/47 (31%), Positives = 19/47 (40%) Frame = -1 Query: 303 QYFTAVFFFHVFRCQFXMLTVCMLSYSIYFSNGFTLEFWSFVLCSKS 163 ++F + FF VF C F YS GF + F V C S Sbjct: 351 EFFFSNFFMVVFACMFFFSVFLTFGYSYRLWKGFFMSFSRPVFCFSS 397 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 82,041,190 Number of Sequences: 219361 Number of extensions: 1556599 Number of successful extensions: 3751 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3658 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3751 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5596027262 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)