| Clone Name | rbags21e01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ALEUL_ARATH (Q8RWQ9) Thiol protease aleurain-like precursor (EC ... | 28 | 7.1 | 2 | COX10_YARLI (Q6C0L2) Protoheme IX farnesyltransferase, mitochond... | 28 | 7.1 | 3 | EFTS_MANSM (Q65R71) Elongation factor Ts (EF-Ts) | 27 | 9.3 | 4 | EFTS_HAEIN (P43894) Elongation factor Ts (EF-Ts) | 27 | 9.3 | 5 | EFTS_HAEI8 (Q4QLZ5) Elongation factor Ts (EF-Ts) | 27 | 9.3 |
|---|
>ALEUL_ARATH (Q8RWQ9) Thiol protease aleurain-like precursor (EC 3.4.22.16)| Length = 358 Score = 27.7 bits (60), Expect = 7.1 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +2 Query: 35 NIGSLAGLNMRGLSFQLCIIQFASIYWFLFNSF 133 N+ + N +GLS++L + QFA + W F + Sbjct: 86 NLDLIRSTNKKGLSYKLSLNQFADLTWQEFQRY 118
>COX10_YARLI (Q6C0L2) Protoheme IX farnesyltransferase, mitochondrial precursor| (EC 2.5.1.-) (Heme O synthase) Length = 471 Score = 27.7 bits (60), Expect = 7.1 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Frame = +2 Query: 29 NPNIGSLAGLNMRGLSFQLCI-IQFASI--YWFLFNSFANN*LID*WAF 166 NP + + GL L F LC+ + + ++ +WF+ +S N + WAF Sbjct: 355 NPGLNARVGLRYALLMFPLCVGLSYYNVTDWWFVLDSSVLNAWMAWWAF 403
>EFTS_MANSM (Q65R71) Elongation factor Ts (EF-Ts)| Length = 281 Score = 27.3 bits (59), Expect = 9.3 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 363 TIGNFIRLEVGEGI 322 ++ NFIRLEVGEGI Sbjct: 251 SVANFIRLEVGEGI 264
>EFTS_HAEIN (P43894) Elongation factor Ts (EF-Ts)| Length = 282 Score = 27.3 bits (59), Expect = 9.3 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 363 TIGNFIRLEVGEGI 322 ++ NFIRLEVGEGI Sbjct: 250 SVSNFIRLEVGEGI 263
>EFTS_HAEI8 (Q4QLZ5) Elongation factor Ts (EF-Ts)| Length = 282 Score = 27.3 bits (59), Expect = 9.3 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 363 TIGNFIRLEVGEGI 322 ++ NFIRLEVGEGI Sbjct: 250 SVSNFIRLEVGEGI 263 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,435,911 Number of Sequences: 219361 Number of extensions: 770577 Number of successful extensions: 1517 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1508 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1517 length of database: 80,573,946 effective HSP length: 99 effective length of database: 58,857,207 effective search space used: 1412572968 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)