| Clone Name | rbags20o09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RS143_ARATH (P42036) 40S ribosomal protein S14-3 | 40 | 0.007 | 2 | RS142_MAIZE (P19951) 40S ribosomal protein S14 (Clone MCH2) | 37 | 0.057 | 3 | RS142_ARATH (Q9CAX6) 40S ribosomal protein S14-2 | 37 | 0.057 | 4 | RS141_ARATH (Q9SIH0) 40S ribosomal protein S14-1 | 36 | 0.097 | 5 | RS141_MAIZE (P19950) 40S ribosomal protein S14 (Clone MCH1) | 35 | 0.28 | 6 | RS14_LUPLU (O22584) 40S ribosomal protein S14 | 33 | 0.82 | 7 | G10_BRARE (Q567Z7) Protein G10 homolog | 30 | 7.0 |
|---|
>RS143_ARATH (P42036) 40S ribosomal protein S14-3| Length = 150 Score = 40.0 bits (92), Expect = 0.007 Identities = 18/33 (54%), Positives = 23/33 (69%) Frame = -3 Query: 313 KRKTREPKWGNVTVEPVVREGDHVFDIAQSLAT 215 KRKT+EPK NVT+ P VREG+ VF + A+ Sbjct: 3 KRKTKEPKVENVTLGPAVREGEQVFGVVHVFAS 35
>RS142_MAIZE (P19951) 40S ribosomal protein S14 (Clone MCH2)| Length = 150 Score = 37.0 bits (84), Expect = 0.057 Identities = 18/33 (54%), Positives = 24/33 (72%) Frame = -3 Query: 313 KRKTREPKWGNVTVEPVVREGDHVFDIAQSLAT 215 ++KTREPK NV + P VREG+HVF +A A+ Sbjct: 4 RKKTREPKEENV-LGPAVREGEHVFGVAHIFAS 35
>RS142_ARATH (Q9CAX6) 40S ribosomal protein S14-2| Length = 150 Score = 37.0 bits (84), Expect = 0.057 Identities = 17/33 (51%), Positives = 22/33 (66%) Frame = -3 Query: 313 KRKTREPKWGNVTVEPVVREGDHVFDIAQSLAT 215 KRKT+EPK VT+ P VREG+ VF + A+ Sbjct: 3 KRKTKEPKVETVTLGPSVREGEQVFGVVHIFAS 35
>RS141_ARATH (Q9SIH0) 40S ribosomal protein S14-1| Length = 150 Score = 36.2 bits (82), Expect = 0.097 Identities = 17/33 (51%), Positives = 22/33 (66%) Frame = -3 Query: 313 KRKTREPKWGNVTVEPVVREGDHVFDIAQSLAT 215 KRKT+EPK VT+ P VREG+ VF + A+ Sbjct: 3 KRKTKEPKVDVVTLGPSVREGEQVFGVVHIFAS 35
>RS141_MAIZE (P19950) 40S ribosomal protein S14 (Clone MCH1)| Length = 149 Score = 34.7 bits (78), Expect = 0.28 Identities = 18/33 (54%), Positives = 23/33 (69%) Frame = -3 Query: 313 KRKTREPKWGNVTVEPVVREGDHVFDIAQSLAT 215 +RKTREPK NV + P VREG+ VF +A A+ Sbjct: 3 RRKTREPKEENV-LGPTVREGEFVFGVAHIFAS 34
>RS14_LUPLU (O22584) 40S ribosomal protein S14| Length = 150 Score = 33.1 bits (74), Expect = 0.82 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = -3 Query: 313 KRKTREPKWGNVTVEPVVREGDHVFDIAQSLAT 215 +RK R+ K VT+ P V +G+HVF +A+ A+ Sbjct: 3 RRKVRDTKEETVTLGPAVSDGEHVFGVARIFAS 35
>G10_BRARE (Q567Z7) Protein G10 homolog| Length = 144 Score = 30.0 bits (66), Expect = 7.0 Identities = 20/63 (31%), Positives = 30/63 (47%) Frame = -3 Query: 325 MCKFKRKTREPKWGNVTVEPVVREGDHVFDIAQSLATEEGMLLFCLFPVLTMVAQRVRHV 146 M K KR + P G VEP + E D A++ E + L+P+ + QR R++ Sbjct: 1 MPKVKRSRKPPPDGWELVEPTLDELDQKMREAETEPHEGKRKVESLWPIFRLHHQRSRYI 60 Query: 145 FHL 137 F L Sbjct: 61 FDL 63 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 103,625,077 Number of Sequences: 219361 Number of extensions: 2286702 Number of successful extensions: 5936 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 5666 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5933 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6882837918 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)