| Clone Name | rbags20n14 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YL076_MIMIV (Q5UPF2) Putative BTB/POZ domain-containing protein L76 | 30 | 7.7 |
|---|
>YL076_MIMIV (Q5UPF2) Putative BTB/POZ domain-containing protein L76| Length = 551 Score = 30.0 bits (66), Expect = 7.7 Identities = 22/67 (32%), Positives = 32/67 (47%) Frame = -3 Query: 719 VSISILTKRCEVILGQFLADENDLGDRPLPSVRIEETVCVLQELARLILDIETANALNIP 540 VS S++TK I+ F END+ D P +EE +C ++ L D T +N+P Sbjct: 68 VSNSLITKN---IIKSFYGQENDVIDIPDWQYILEEIIC--KDYLGLDYDTSTLKDINVP 122 Query: 539 LYLKDAL 519 D L Sbjct: 123 SEYYDLL 129 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 97,471,345 Number of Sequences: 219361 Number of extensions: 1838237 Number of successful extensions: 3819 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3758 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3819 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7592921998 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)