| Clone Name | rbaal0a03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ADEN_ADEB4 (O71150) Adenain (EC 3.4.22.39) (Endoprotease) (Late ... | 30 | 1.4 | 2 | V1BR_HUMAN (P47901) Vasopressin V1b receptor (V1bR) (AVPR V1b) (... | 28 | 7.0 | 3 | PDR9_ARATH (Q9LFH0) Probable pleiotropic drug resistance protein 9 | 27 | 9.1 | 4 | EMID1_HUMAN (Q96A84) EMI domain-containing protein 1 precursor (... | 27 | 9.1 |
|---|
>ADEN_ADEB4 (O71150) Adenain (EC 3.4.22.39) (Endoprotease) (Late L3 23 kDa| protein) Length = 201 Score = 30.0 bits (66), Expect = 1.4 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +3 Query: 303 RNLNDASPAQRPCDPSSYHESSD 371 ++LN ASP+ P DPSS H++ D Sbjct: 147 QSLNGASPSLTPSDPSSLHKNQD 169
>V1BR_HUMAN (P47901) Vasopressin V1b receptor (V1bR) (AVPR V1b) (Vasopressin V3| receptor) (AVPR V3) (Antidiuretic hormone receptor 1b) Length = 424 Score = 27.7 bits (60), Expect = 7.0 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 4/57 (7%) Frame = +1 Query: 73 VKGFRLYSFQLPDTNAPGIVIYCHYLPVSGLGNLRACCLPWMW*PF----LRLPLRN 231 V+ + ++ PD ++ + L LGNL +CC PW++ F L PLR+ Sbjct: 300 VQMWSVWDKNAPDEDSTNVAFTISML----LGNLNSCCNPWIYMGFNSHLLPRPLRH 352
>PDR9_ARATH (Q9LFH0) Probable pleiotropic drug resistance protein 9| Length = 1450 Score = 27.3 bits (59), Expect = 9.1 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +1 Query: 58 LQWILVKGFRLYS-FQLPDTNAPGIVIYCHYL 150 LQ + GF L+S F +P T PG I+ +YL Sbjct: 1343 LQSLFYVGFNLFSGFLIPQTQVPGWWIWLYYL 1374
>EMID1_HUMAN (Q96A84) EMI domain-containing protein 1 precursor (Protein Emu1)| (Emilin and multimerin domain-containing protein 1) Length = 441 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/47 (25%), Positives = 21/47 (44%) Frame = +2 Query: 83 LDCTHSNYQTLTRPVLLFIVTTSPCQDWVICAPAAFLGCGSRFSGSL 223 + C S+Y+T+ RP + ++W C + + C S SL Sbjct: 66 MSCPGSSYRTVVRPTYKVMYKIVTAREWRCCPGHSGVSCEEASSASL 112 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,701,416 Number of Sequences: 219361 Number of extensions: 1021135 Number of successful extensions: 1981 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1962 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1981 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 1391514312 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)