| Clone Name | rbags21b23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | AMPM_HELVI (Q11000) Membrane alanyl aminopeptidase precursor (EC... | 32 | 2.0 | 2 | CP314_DROME (Q9VUF8) Cytochrome P450 314a1, mitochondrial precur... | 30 | 5.8 | 3 | GOGA4_HUMAN (Q13439) Golgin subfamily A member 4 (Trans-Golgi p2... | 30 | 7.6 | 4 | NBP1_YEAST (P52919) NAP1-binding protein | 30 | 9.9 |
|---|
>AMPM_HELVI (Q11000) Membrane alanyl aminopeptidase precursor (EC 3.4.11.-)| (Aminopeptidase N-like protein) (CryIA(C) receptor) (BTBP1) Length = 1009 Score = 32.0 bits (71), Expect = 2.0 Identities = 22/82 (26%), Positives = 31/82 (37%), Gaps = 3/82 (3%) Frame = +1 Query: 235 SQYAKTPSLARGRFIRIWLPETQMPSTLSAMCFPC---AGIKPDVCNDLIRPLSSESWAA 405 S Y P A R W+ TQ +T + FPC G K + RP+ SW Sbjct: 176 SWYRNLPDDANVR----WMATTQFQATAARYAFPCYDEPGFKAKFDVTIRRPVGYSSWFC 231 Query: 406 ISRSDSEPILRTRWSDDPFRIT 471 + S P + +D + T Sbjct: 232 TRQKGSGPSTVAGYEEDEYHTT 253
>CP314_DROME (Q9VUF8) Cytochrome P450 314a1, mitochondrial precursor (EC| 1.14.99.22) (CYPCCCXIVA1) (Ecdysone 20-monooxygenase) (E20MO) (Shade protein) Length = 540 Score = 30.4 bits (67), Expect = 5.8 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = -1 Query: 647 KVKMLEDLYHSQLVQPEVSKDR 582 K +LED YH++L+QPE K R Sbjct: 34 KNTLLEDFYHAELIQPEAPKRR 55
>GOGA4_HUMAN (Q13439) Golgin subfamily A member 4 (Trans-Golgi p230) (256 kDa| golgin) (Golgin-245) (Protein 72.1) Length = 2230 Score = 30.0 bits (66), Expect = 7.6 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = -1 Query: 701 ELGSKLQAREKTVDELSAKVKMLEDLYHSQLVQPEVSKDRA 579 EL +KLQ RE+ V L K+K +E L+ P +K+ A Sbjct: 1676 ELNTKLQEREREVHILEEKLKSVESSQSETLIVPRSAKNVA 1716
>NBP1_YEAST (P52919) NAP1-binding protein| Length = 319 Score = 29.6 bits (65), Expect = 9.9 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = -1 Query: 698 LGSKLQAREKTVDELSAKVKMLEDLYHSQLVQPEVSKDR 582 L SKLQ+ ++ ++ + K ++LEDL S + P +K R Sbjct: 192 LESKLQSLQEALNYSNEKYRILEDLLDSSNIHPSYTKSR 230 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 103,440,034 Number of Sequences: 219361 Number of extensions: 2190803 Number of successful extensions: 6317 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6063 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6309 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7479594804 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)