ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbags20m23 |
|---|---|
| Clone Library Name | barley_pub |
>NEC1_NICLS (Q94EG3) Nectarin-1 precursor (EC 1.15.1.1) (Superoxide dismutase| [Mn]) Length = 229 Score = 38.5 bits (88), Expect = 0.005 Identities = 15/28 (53%), Positives = 22/28 (78%) Frame = -3 Query: 181 ASPPVPTDVLAKAFRVDNEDXDAVKARF 98 ASPPVP DVLA+ F+++ ED +K++F Sbjct: 196 ASPPVPDDVLAQTFQINTEDVQQIKSKF 223
>NEC1_NICPL (Q9SPV5) Nectarin-1 precursor (EC 1.15.1.1) (Superoxide dismutase| [Mn]) Length = 229 Score = 34.3 bits (77), Expect = 0.094 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = -3 Query: 181 ASPPVPTDVLAKAFRVDNEDXDAVKARF 98 ASP VP DVLA+ F+++ ED +K++F Sbjct: 196 ASPTVPDDVLAQTFQINIEDVQQIKSKF 223
>RHRE_PEA (Q9S8P4) Rhicadhesin receptor precursor (Germin-like protein)| Length = 217 Score = 33.1 bits (74), Expect = 0.21 Identities = 12/28 (42%), Positives = 21/28 (75%) Frame = -3 Query: 181 ASPPVPTDVLAKAFRVDNEDXDAVKARF 98 A+PPVP +VL KAF++ ++ +K++F Sbjct: 186 ATPPVPDNVLTKAFQIGTKEVQKIKSKF 213
>GER2_WHEAT (P15290) Oxalate oxidase GF-2.8 precursor (EC 1.2.3.4) (Germin| GF-2.8) Length = 224 Score = 31.2 bits (69), Expect = 0.79 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = -3 Query: 181 ASPPVPTDVLAKAFRVDNEDXDAVKARFK*G 89 ++PP+PT VL KA RV+ + +K++F G Sbjct: 193 SNPPIPTPVLTKALRVEARVVELLKSKFAAG 223
>OXO1_HORVU (P45850) Oxalate oxidase 1 (EC 1.2.3.4) (Germin)| Length = 201 Score = 30.4 bits (67), Expect = 1.4 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = -3 Query: 181 ASPPVPTDVLAKAFRVDNEDXDAVKARFK*GA 86 + PP+PT VL KA RV+ + +K++F G+ Sbjct: 170 SDPPIPTPVLTKALRVEAGVVELLKSKFAGGS 201
>OXO2_HORVU (P45851) Oxalate oxidase 2 precursor (EC 1.2.3.4) (Germin)| Length = 224 Score = 30.4 bits (67), Expect = 1.4 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = -3 Query: 181 ASPPVPTDVLAKAFRVDNEDXDAVKARFK*G 89 ++PP+PT VL KA RV+ + +K++F G Sbjct: 193 SNPPIPTPVLTKALRVEAGVVELLKSKFAAG 223
>GL23_ARATH (P93000) Germin-like protein subfamily 2 member 3 precursor| Length = 219 Score = 29.3 bits (64), Expect = 3.0 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = -3 Query: 181 ASPPVPTDVLAKAFRVDNEDXDAVKARF 98 ++PP+P D+LAKAF + +K +F Sbjct: 188 SNPPIPDDLLAKAFGAAAPEIQKIKGKF 215
>RT12_PARTE (P15755) Mitochondrial ribosomal protein S12| Length = 139 Score = 28.1 bits (61), Expect = 6.7 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = -1 Query: 177 HRRCRPTCWPRPSGLITKTX--TPSRPGSSREPLPSATLSIXRF 52 +R C P+ G + K TP +P S+R P+ A L+ +F Sbjct: 19 NRSAALVCCPQKEGSVLKPRIVTPKKPNSARRPVAKAKLTNKKF 62
>GL119_ARATH (Q9FL89) Germin-like protein subfamily 1 member 19 precursor| Length = 221 Score = 28.1 bits (61), Expect = 6.7 Identities = 11/29 (37%), Positives = 21/29 (72%) Frame = -3 Query: 181 ASPPVPTDVLAKAFRVDNEDXDAVKARFK 95 ++PP+ D+LA+AF++D ++A+FK Sbjct: 192 STPPINPDILAQAFQLDVNVVKDLEAKFK 220
>GL117_ARATH (Q9FIC6) Germin-like protein subfamily 1 member 17 precursor| Length = 221 Score = 28.1 bits (61), Expect = 6.7 Identities = 11/29 (37%), Positives = 21/29 (72%) Frame = -3 Query: 181 ASPPVPTDVLAKAFRVDNEDXDAVKARFK 95 ++PP+ D+LA+AF++D ++A+FK Sbjct: 192 STPPINPDILAQAFQLDVNVVKDLEAKFK 220
>GL115_ARATH (Q9FIC9) Germin-like protein subfamily 1 member 15 precursor| Length = 221 Score = 28.1 bits (61), Expect = 6.7 Identities = 11/29 (37%), Positives = 21/29 (72%) Frame = -3 Query: 181 ASPPVPTDVLAKAFRVDNEDXDAVKARFK 95 ++PP+ D+LA+AF++D ++A+FK Sbjct: 192 STPPINPDILAQAFQLDVNVVKDLEAKFK 220
>GL114_ARATH (Q9FID0) Germin-like protein subfamily 1 member 14 precursor| Length = 222 Score = 28.1 bits (61), Expect = 6.7 Identities = 11/29 (37%), Positives = 21/29 (72%) Frame = -3 Query: 181 ASPPVPTDVLAKAFRVDNEDXDAVKARFK 95 ++PP+ D+LA+AF++D ++A+FK Sbjct: 193 STPPINPDILAQAFQLDVNVVKDLEAKFK 221
>PLXB2_HUMAN (O15031) Plexin-B2 precursor (MM1)| Length = 1838 Score = 27.7 bits (60), Expect = 8.8 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -1 Query: 159 TCWPRPSGLITKTXTPSRPGSSREPLPSATLSIXRFGR 46 +CWPRP ++ + RPGS+ + L L+ + GR Sbjct: 1505 SCWPRPDSVVLEW----RPGSTAQILSDLDLTSQQEGR 1538
>LYPD3_HUMAN (O95274) Ly6/PLAUR domain-containing protein 3 precursor| (GPI-anchored metastasis-associated protein C4.4A homolog) (Matrigel-induced gene C4 protein) (MIG-C4) Length = 346 Score = 27.7 bits (60), Expect = 8.8 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = -1 Query: 162 PTCWPRPSGLITKTXTPSRPGSSREPLPSATLSIXRFG 49 PT + + T T P RP S+ +P+P+ T R G Sbjct: 246 PTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQG 283 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,804,886 Number of Sequences: 219361 Number of extensions: 297613 Number of successful extensions: 1209 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1046 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1207 length of database: 80,573,946 effective HSP length: 36 effective length of database: 72,676,950 effective search space used: 1744246800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
