| Clone Name | rbaak4p23 |
|---|---|
| Clone Library Name | barley_pub |
>RBS3_WHEAT (P07398) Ribulose bisphosphate carboxylase small chain clone 512| (EC 4.1.1.39) (RuBisCO small subunit) (Fragment) Length = 113 Score = 87.4 bits (215), Expect = 8e-18 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -3 Query: 372 VKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESGKA 253 VKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESGKA Sbjct: 74 VKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESGKA 113
>RBS_HORVU (Q40004) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 174 Score = 86.3 bits (212), Expect = 2e-17 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -3 Query: 372 VKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESGKA 253 VKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGC+ESGKA Sbjct: 135 VKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCQESGKA 174
>RBS2_WHEAT (P26667) Ribulose bisphosphate carboxylase small chain PW9,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PW9) Length = 175 Score = 85.9 bits (211), Expect = 2e-17 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -3 Query: 372 VKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESGKA 253 VKKEYPDAYVR+IGFDNMRQVQCVSFIAF+PPGCEESGKA Sbjct: 136 VKKEYPDAYVRVIGFDNMRQVQCVSFIAFRPPGCEESGKA 175
>RBS1_WHEAT (P00871) Ribulose bisphosphate carboxylase small chain PWS4.3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PWS4.3) Length = 174 Score = 84.7 bits (208), Expect = 5e-17 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = -3 Query: 372 VKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESGKA 253 VKKEYPDAYVR+IGFDN+RQVQCVSFIAF+PPGCEESGKA Sbjct: 135 VKKEYPDAYVRVIGFDNLRQVQCVSFIAFRPPGCEESGKA 174
>RBS_AEGTA (Q38793) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 175 Score = 75.5 bits (184), Expect = 3e-14 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = -3 Query: 372 VKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESGKA 253 V+KEYPD Y RIIGFDNMRQVQ VSFIA KPPGCEESGKA Sbjct: 136 VRKEYPDPYCRIIGFDNMRQVQSVSFIASKPPGCEESGKA 175
>RBS3_ORYSA (P18567) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 175 Score = 71.6 bits (174), Expect = 4e-13 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESG 259 KK YPDA+VRIIGFDN+RQVQ +SFIA+KPPGCEESG Sbjct: 137 KKAYPDAFVRIIGFDNVRQVQLISFIAYKPPGCEESG 173
>RBS2_ORYSA (P18566) Ribulose bisphosphate carboxylase small chain A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit A) Length = 175 Score = 71.2 bits (173), Expect = 6e-13 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESG 259 KK YPDA++RIIGFDN+RQVQ +SFIA+KPPGCEESG Sbjct: 137 KKAYPDAFIRIIGFDNVRQVQLISFIAYKPPGCEESG 173
>RBS1_ORYSA (P05347) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 172 Score = 62.4 bits (150), Expect = 3e-10 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESG 259 KK YPDA+VRIIGFDN+RQVQ +SFIA+ PGCEESG Sbjct: 135 KKAYPDAFVRIIGFDNVRQVQLISFIAYN-PGCEESG 170
>RBS3_AMAHP (Q9XGX4) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 180 Score = 62.4 bits (150), Expect = 3e-10 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 274 KK YP A++RIIGFDN RQVQCVSFIAFKPPG Sbjct: 148 KKAYPSAFIRIIGFDNKRQVQCVSFIAFKPPG 179
>RBS3B_ARATH (P10798) Ribulose bisphosphate carboxylase small chain 3B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3B) Length = 181 Score = 61.6 bits (148), Expect = 4e-10 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEES 262 KKEYP A++RIIGFDN RQVQC+SFIA+KPP E+ Sbjct: 146 KKEYPGAFIRIIGFDNTRQVQCISFIAYKPPSFTEA 181
>RBS2B_ARATH (P10797) Ribulose bisphosphate carboxylase small chain 2B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2B) Length = 181 Score = 61.6 bits (148), Expect = 4e-10 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEES 262 KKEYP A++RIIGFDN RQVQC+SFIA+KPP E+ Sbjct: 146 KKEYPGAFIRIIGFDNTRQVQCISFIAYKPPSFTEA 181
>RBS2_PETHY (P04715) Ribulose bisphosphate carboxylase small chain SSU11A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU11A) Length = 180 Score = 61.6 bits (148), Expect = 4e-10 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 274 KK YP+A++RIIGFDN+RQVQC+SFIA+KPPG Sbjct: 148 KKAYPNAWIRIIGFDNVRQVQCISFIAYKPPG 179
>RBS1_PETHY (P04714) Ribulose bisphosphate carboxylase small chain SSU8,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU8) Length = 180 Score = 61.6 bits (148), Expect = 4e-10 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 274 KK YP+A++RIIGFDN+RQVQC+SFIA+KPPG Sbjct: 148 KKAYPNAWIRIIGFDNVRQVQCISFIAYKPPG 179
>RBS_GOSHI (P31333) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 61.2 bits (147), Expect = 6e-10 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 274 KKEYP+A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 150 KKEYPNAFIRIIGFDNVRQVQCISFIAYKPKG 181
>RBS1A_ARATH (P10795) Ribulose bisphosphate carboxylase small chain 1A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1A) Length = 180 Score = 61.2 bits (147), Expect = 6e-10 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPP 277 KKEYP+A++RIIGFDN RQVQC+SFIA+KPP Sbjct: 146 KKEYPNAFIRIIGFDNTRQVQCISFIAYKPP 176
>RBS_SINAL (P13951) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) (Fragment) Length = 82 Score = 60.8 bits (146), Expect = 8e-10 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPP 277 KKEYP+A++RIIGFDN RQVQC+SFIA+KPP Sbjct: 47 KKEYPNAFIRIIGFDNNRQVQCISFIAYKPP 77
>RBS_CUCSA (P08474) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 189 Score = 60.8 bits (146), Expect = 8e-10 Identities = 24/30 (80%), Positives = 30/30 (100%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 280 KKEYPDA++R+IGFDN+RQVQC+SFIA+KP Sbjct: 150 KKEYPDAFIRVIGFDNVRQVQCISFIAYKP 179
>RBS_LACSA (Q40250) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 60.5 bits (145), Expect = 1e-09 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 274 KKEYP+A++R+IGFDN+RQVQC+SFI KPPG Sbjct: 148 KKEYPNAFIRVIGFDNIRQVQCISFIVAKPPG 179
>RBS1B_ARATH (P10796) Ribulose bisphosphate carboxylase small chain 1B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1B) Length = 181 Score = 60.5 bits (145), Expect = 1e-09 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPP 277 KKEYP A++RIIGFDN RQVQC+SFIA+KPP Sbjct: 146 KKEYPGAFIRIIGFDNTRQVQCISFIAYKPP 176
>RBS_RAPSA (P08135) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 59.3 bits (142), Expect = 2e-09 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPP 277 KKEYP+A +RIIGFDN RQVQC+SFIA+KPP Sbjct: 146 KKEYPNALIRIIGFDNNRQVQCISFIAYKPP 176
>RBS_MUSAC (O24045) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 59.3 bits (142), Expect = 2e-09 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 274 KKEYP A++RIIGFDN RQVQC+SFIA+KP G Sbjct: 148 KKEYPHAFIRIIGFDNNRQVQCISFIAYKPTG 179
>RBS_FLATR (P07089) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 173 Score = 58.9 bits (141), Expect = 3e-09 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 274 KKEYP A++RIIGFDN+RQVQCVSFIA KP G Sbjct: 141 KKEYPQAWIRIIGFDNVRQVQCVSFIASKPTG 172
>RBS2_BRANA (P27985) Ribulose bisphosphate carboxylase small chain F1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit F1) Length = 181 Score = 58.5 bits (140), Expect = 4e-09 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPP 277 K EYP+A++RIIGFDN RQVQC+SFIA+KPP Sbjct: 146 KTEYPNAFIRIIGFDNNRQVQCISFIAYKPP 176
>RBS1_SOLTU (P26574) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 181 Score = 58.5 bits (140), Expect = 4e-09 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 274 KK YP A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 149 KKSYPQAWIRIIGFDNVRQVQCISFIAYKPEG 180
>RBS1_LYCES (P08706) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) (LESS17) Length = 181 Score = 58.5 bits (140), Expect = 4e-09 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 274 KK YP A+VRIIGFDN+RQVQC+SFIA+KP G Sbjct: 149 KKAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 180
>RBS1_BRANA (P05346) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 58.5 bits (140), Expect = 4e-09 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPP 277 K EYP+A++RIIGFDN RQVQC+SFIA+KPP Sbjct: 146 KTEYPNAFIRIIGFDNNRQVQCISFIAYKPP 176
>RBS4_FLAPR (Q39746) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 178 Score = 58.5 bits (140), Expect = 4e-09 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 274 KKEYP A++RIIGFDN+RQVQC+SFIA KP G Sbjct: 146 KKEYPQAWIRIIGFDNVRQVQCISFIASKPDG 177
>RBS2_FLAPR (Q39744) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 178 Score = 58.5 bits (140), Expect = 4e-09 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 274 KKEYP A++RIIGFDN+RQVQC+SFIA KP G Sbjct: 146 KKEYPQAWIRIIGFDNVRQVQCISFIASKPEG 177
>RBS7_FLAPR (Q39749) Ribulose bisphosphate carboxylase small chain 7,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 7) Length = 173 Score = 58.5 bits (140), Expect = 4e-09 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 274 KKEYP A++RIIGFDN+RQVQC+SFIA KP G Sbjct: 141 KKEYPQAWIRIIGFDNVRQVQCISFIASKPDG 172
>RBS5_FLAPR (Q39747) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 173 Score = 58.5 bits (140), Expect = 4e-09 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 274 KKEYP A++RIIGFDN+RQVQC+SFIA KP G Sbjct: 141 KKEYPQAWIRIIGFDNVRQVQCISFIASKPDG 172
>RBS3_FLAPR (Q39745) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 173 Score = 58.5 bits (140), Expect = 4e-09 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 274 KKEYP A++RIIGFDN+RQVQC+SFIA KP G Sbjct: 141 KKEYPQAWIRIIGFDNVRQVQCISFIASKPDG 172
>RBS_MANES (Q42915) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 58.5 bits (140), Expect = 4e-09 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -3 Query: 366 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 274 K +PD Y RIIGFDN+RQVQC+SF+A+KPPG Sbjct: 151 KHHPDGYARIIGFDNVRQVQCISFLAYKPPG 181
>RBS_STELP (Q41351) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 58.5 bits (140), Expect = 4e-09 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 280 KK YPDA++RIIGFDN+RQVQC+SFIA+KP Sbjct: 148 KKAYPDAHIRIIGFDNVRQVQCISFIAYKP 177
>RBS8_NICPL (P26573) Ribulose bisphosphate carboxylase small chain 8B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 8B) Length = 180 Score = 58.5 bits (140), Expect = 4e-09 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 274 KK YP A+VRIIGFDN+RQVQC+SFIA+KP G Sbjct: 148 KKAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 179
>RBS3B_LYCES (P05349) Ribulose bisphosphate carboxylase small chain 3B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3B) Length = 180 Score = 58.5 bits (140), Expect = 4e-09 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 274 KK YP A+VRIIGFDN+RQVQC+SFIA+KP G Sbjct: 148 KKAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 179
>RBS3A_LYCES (P07180) Ribulose bisphosphate carboxylase small chain 3A/3C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3A/3C) Length = 180 Score = 58.5 bits (140), Expect = 4e-09 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 274 KK YP A+VRIIGFDN+RQVQC+SFIA+KP G Sbjct: 148 KKAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 179
>RBS2_SPIOL (Q43832) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 180 Score = 58.5 bits (140), Expect = 4e-09 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 274 KKEYP+A++RIIGFD+ RQVQCVSFIA+KP G Sbjct: 148 KKEYPNAFIRIIGFDSNRQVQCVSFIAYKPAG 179
>RBS2A_LYCES (P07179) Ribulose bisphosphate carboxylase small chain 2A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2A) (LESS 5) Length = 180 Score = 58.5 bits (140), Expect = 4e-09 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 274 KK YP A+VRIIGFDN+RQVQC+SFIA+KP G Sbjct: 148 KKAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 179
>RBS3_SOLTU (P32764) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 181 Score = 58.2 bits (139), Expect = 5e-09 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 274 KK YP A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 149 KKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 180
>RBS2_NICSY (P22433) Ribulose bisphosphate carboxylase small chain S41,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit S41) Length = 181 Score = 58.2 bits (139), Expect = 5e-09 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 274 KK YP A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 149 KKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 180
>RBS1_AMAHP (Q42516) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 183 Score = 58.2 bits (139), Expect = 5e-09 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 274 KK YP A++RIIGFDN RQVQCVSFIA+KP G Sbjct: 150 KKAYPSAFIRIIGFDNKRQVQCVSFIAYKPAG 181
>RBS1_SOYBN (P00865) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 178 Score = 58.2 bits (139), Expect = 5e-09 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 274 K YP+ ++RIIGFDN+RQVQC+SFIA+KPPG Sbjct: 146 KTAYPNGFIRIIGFDNVRQVQCISFIAYKPPG 177
>RBS1_FLAPR (Q39743) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 173 Score = 58.2 bits (139), Expect = 5e-09 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 274 KKEYP A++RIIGFDN+RQVQC+SFIA KP G Sbjct: 141 KKEYPQAWIRIIGFDNVRQVQCISFIASKPGG 172
>RBS_TOBAC (P69249) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) (TSSU3-8) Length = 180 Score = 58.2 bits (139), Expect = 5e-09 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 274 KK YP A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 148 KKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 179
>RBSC_SOLTU (P26577) Ribulose bisphosphate carboxylase small chain 2C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2C) Length = 180 Score = 58.2 bits (139), Expect = 5e-09 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 274 KK YP A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 148 KKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 179
>RBSB_SOLTU (P26576) Ribulose bisphosphate carboxylase small chain 2B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2B) Length = 180 Score = 58.2 bits (139), Expect = 5e-09 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 274 KK YP A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 148 KKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 179
>RBSA_SOLTU (P26575) Ribulose bisphosphate carboxylase small chain 2A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2A) Length = 180 Score = 58.2 bits (139), Expect = 5e-09 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 274 KK YP A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 148 KKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 179
>RBS1_NICSY (P69250) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 58.2 bits (139), Expect = 5e-09 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 274 KK YP A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 148 KKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 179
>RBS_HEVBR (P29684) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 57.8 bits (138), Expect = 6e-09 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -3 Query: 366 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCE 268 K YPD Y RIIGFDN+RQVQC+SF+A+KP G E Sbjct: 151 KAYPDCYGRIIGFDNVRQVQCISFLAYKPKGAE 183
>RBS4_MESCR (Q08184) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 183 Score = 57.8 bits (138), Expect = 6e-09 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 280 KK YP+A++RIIGFDN+RQVQCVSFIA+KP Sbjct: 149 KKAYPEAFIRIIGFDNVRQVQCVSFIAYKP 178
>RBS_MAIZE (P05348) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 170 Score = 57.8 bits (138), Expect = 6e-09 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = -3 Query: 366 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCE 268 K YPDA+ R+IGFDN++Q QCVSFIA+KPPG + Sbjct: 138 KSYPDAFHRVIGFDNIKQTQCVSFIAYKPPGSD 170
>RBS6_MESCR (Q08186) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) Length = 186 Score = 57.8 bits (138), Expect = 6e-09 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 280 KK YP+A++RIIGFDN+RQVQCVSFIA+KP Sbjct: 152 KKAYPEAFIRIIGFDNVRQVQCVSFIAYKP 181
>RBS5_MESCR (Q08185) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 182 Score = 57.8 bits (138), Expect = 6e-09 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 280 KK YP+A++RIIGFDN+RQVQCVSFIA+KP Sbjct: 148 KKAYPEAFIRIIGFDNVRQVQCVSFIAYKP 177
>RBS_PYRPY (P24007) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 57.4 bits (137), Expect = 8e-09 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 274 KK YP +++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 151 KKAYPQSFIRIIGFDNVRQVQCISFIAYKPAG 182
>RBS_MALSP (Q02980) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 57.4 bits (137), Expect = 8e-09 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 274 KK YP +++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 151 KKAYPQSFIRIIGFDNVRQVQCISFIAYKPAG 182
>RBS3_MESCR (Q08183) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 183 Score = 57.4 bits (137), Expect = 8e-09 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 280 KK YP+A++RIIGFDN+RQVQC+SFIA+KP Sbjct: 149 KKAYPEAFIRIIGFDNVRQVQCISFIAYKP 178
>RBS_GLYTA (Q42823) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 57.4 bits (137), Expect = 8e-09 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPP 277 K YP+A++RIIGFDN+RQVQC+SFIA+KPP Sbjct: 146 KTAYPNAFIRIIGFDNVRQVQCISFIAYKPP 176
>RBS1_MESCR (P16032) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 182 Score = 57.4 bits (137), Expect = 8e-09 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 280 KK YP+A++RIIGFDN+RQVQC+SFIA+KP Sbjct: 148 KKAYPEAFIRIIGFDNVRQVQCISFIAYKP 177
>RBS_BETVE (Q96542) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 57.0 bits (136), Expect = 1e-08 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 274 KK YP A++RIIGFDN RQVQ +SFIA+KPPG Sbjct: 150 KKAYPSAFIRIIGFDNKRQVQIISFIAYKPPG 181
>RBS6_FLAPR (Q39748) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) Length = 173 Score = 56.6 bits (135), Expect = 1e-08 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 280 KKEYP A++RIIGFDN+RQVQC+SFIA KP Sbjct: 141 KKEYPQAWIRIIGFDNVRQVQCISFIASKP 170
>RBS_CAPAN (O65349) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 187 Score = 56.2 bits (134), Expect = 2e-08 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 280 KK YP A++RIIGFDN+RQVQC+SFIA+KP Sbjct: 148 KKAYPQAWIRIIGFDNVRQVQCISFIAYKP 177
>RBS2_MESCR (Q04450) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 180 Score = 56.2 bits (134), Expect = 2e-08 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 280 KK YP+A+ RIIGFDN+RQVQC+SFIA+KP Sbjct: 146 KKAYPEAFTRIIGFDNVRQVQCISFIAYKP 175
>RBS_SILPR (P18960) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 177 Score = 56.2 bits (134), Expect = 2e-08 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 280 K YPDA+VRIIGFDN RQVQC+SFIA+KP Sbjct: 147 KNAYPDAHVRIIGFDNKRQVQCISFIAYKP 176
>RBS0_SOLTU (P10647) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 181 Score = 56.2 bits (134), Expect = 2e-08 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 274 K YP A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 149 KNAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 180
>RBS_GLYTO (Q42822) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 55.8 bits (133), Expect = 2e-08 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPP 277 K YP+ ++RIIGFDN+RQVQC+SFIA+KPP Sbjct: 146 KTAYPNGFIRIIGFDNVRQVQCISFIAYKPP 176
>RBS4_SOYBN (P12468) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 178 Score = 55.8 bits (133), Expect = 2e-08 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPP 277 K YP+ ++RIIGFDN+RQVQC+SFIA+KPP Sbjct: 146 KTAYPNGFIRIIGFDNVRQVQCISFIAYKPP 176
>RBS2_AMAHP (Q9XGX5) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 184 Score = 55.8 bits (133), Expect = 2e-08 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 280 KK YP A++RIIGFDN RQVQCVSFIA+KP Sbjct: 151 KKAYPTAFIRIIGFDNKRQVQCVSFIAYKP 180
>RBS_HELAN (P08705) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 55.5 bits (132), Expect = 3e-08 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 274 KKEYP A++RIIGFDN+RQVQC+ FIA +P G Sbjct: 146 KKEYPQAWIRIIGFDNVRQVQCIMFIASRPDG 177
>RBS_FAGCR (O22077) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 54.7 bits (130), Expect = 5e-08 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = -3 Query: 366 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPP 277 K YP +++RIIGFDN RQVQC+SFIA+KPP Sbjct: 151 KTYPTSHIRIIGFDNKRQVQCISFIAYKPP 180
>RBS6_LEMGI (P19312) Ribulose bisphosphate carboxylase small chain SSU5B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU5B) Length = 177 Score = 54.7 bits (130), Expect = 5e-08 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 280 KK YP+ +VRIIGFDN RQVQC+SFIA+KP Sbjct: 147 KKAYPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS5_LEMGI (P19311) Ribulose bisphosphate carboxylase small chain SSU5A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU5A) Length = 177 Score = 54.7 bits (130), Expect = 5e-08 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 280 KK YP+ +VRIIGFDN RQVQC+SFIA+KP Sbjct: 147 KKAYPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS4_LEMGI (P19310) Ribulose bisphosphate carboxylase small chain SSU40B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU40B) Length = 177 Score = 54.7 bits (130), Expect = 5e-08 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 280 KK YP+ +VRIIGFDN RQVQC+SFIA+KP Sbjct: 147 KKAYPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS3_LEMGI (P19309) Ribulose bisphosphate carboxylase small chain SSU40A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU40A) Length = 177 Score = 54.7 bits (130), Expect = 5e-08 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 280 KK YP+ +VRIIGFDN RQVQC+SFIA+KP Sbjct: 147 KKAYPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS2_LEMGI (P19308) Ribulose bisphosphate carboxylase small chain SSU26,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU26) Length = 177 Score = 54.7 bits (130), Expect = 5e-08 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 280 KK YP+ +VRIIGFDN RQVQC+SFIA+KP Sbjct: 147 KKAYPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS1_LEMGI (P00872) Ribulose bisphosphate carboxylase small chain SSU1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU1) Length = 173 Score = 54.7 bits (130), Expect = 5e-08 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 280 KK YP+ +VRIIGFDN RQVQC+SFIA+KP Sbjct: 143 KKAYPEYFVRIIGFDNKRQVQCISFIAYKP 172
>RBS5_FRIAG (O22645) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 179 Score = 54.3 bits (129), Expect = 7e-08 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 280 KKEYP A++R+IGFDN+RQVQCVSFI KP Sbjct: 149 KKEYPAAFIRVIGFDNVRQVQCVSFIVEKP 178
>RBS3_FRIAG (O22573) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 179 Score = 54.3 bits (129), Expect = 7e-08 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 280 KKEYP A++R+IGFDN+RQVQCVSFI KP Sbjct: 149 KKEYPAAFIRVIGFDNVRQVQCVSFIVEKP 178
>RBS2_FRIAG (O22572) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 179 Score = 54.3 bits (129), Expect = 7e-08 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 280 KKEYP A++R+IGFDN+RQVQCVSFI KP Sbjct: 149 KKEYPAAFIRVIGFDNVRQVQCVSFIVEKP 178
>RBS_MEDSA (O65194) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 53.9 bits (128), Expect = 9e-08 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 280 K EYPD+++RIIGFDN+RQVQC+SFIA P Sbjct: 148 KAEYPDSFIRIIGFDNVRQVQCISFIAHTP 177
>RBS_TRIRP (P17673) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 53.1 bits (126), Expect = 2e-07 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 280 K EYP+A++RIIGFDN+RQVQC+SFIA P Sbjct: 146 KAEYPEAFIRIIGFDNVRQVQCISFIASTP 175
>RBS1_FRIAG (O24634) Ribulose bisphosphate carboxylase small chain 1/4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1/4) Length = 179 Score = 53.1 bits (126), Expect = 2e-07 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 280 KKEYP A++R+IGFDN+RQVQCVSFI +P Sbjct: 149 KKEYPAAFIRVIGFDNVRQVQCVSFIVERP 178
>RBS1_SPIOL (P00870) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 123 Score = 51.6 bits (122), Expect = 5e-07 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -3 Query: 372 VKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 274 VKK PDA+VR IGF++ R+VQC+SFIA+KP G Sbjct: 90 VKKAPPDAFVRFIGFNDKREVQCISFIAYKPAG 122
>RBS_LARLA (P16031) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 189 Score = 51.6 bits (122), Expect = 5e-07 Identities = 20/29 (68%), Positives = 26/29 (89%) Frame = -3 Query: 366 KEYPDAYVRIIGFDNMRQVQCVSFIAFKP 280 K YP+A++R+IGFDN+RQVQC+SFI KP Sbjct: 158 KAYPNAFIRVIGFDNVRQVQCISFIVHKP 186
>RBS_ZANAE (O48550) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 51.2 bits (121), Expect = 6e-07 Identities = 21/31 (67%), Positives = 25/31 (80%) Frame = -3 Query: 366 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 274 K YPD + RIIGFDN RQVQC+SF+ +KP G Sbjct: 147 KAYPDYFNRIIGFDNTRQVQCISFLTYKPEG 177
>RBS_PINTH (P10053) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 171 Score = 50.8 bits (120), Expect = 8e-07 Identities = 20/29 (68%), Positives = 25/29 (86%) Frame = -3 Query: 366 KEYPDAYVRIIGFDNMRQVQCVSFIAFKP 280 K YP A++R+IGFDN+RQVQC+SFI KP Sbjct: 142 KAYPKAFIRVIGFDNVRQVQCISFIVHKP 170
>RBS3_PEA (P07689) Ribulose bisphosphate carboxylase small chain 3A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3A) Length = 180 Score = 49.7 bits (117), Expect = 2e-06 Identities = 21/27 (77%), Positives = 24/27 (88%) Frame = -3 Query: 360 YPDAYVRIIGFDNMRQVQCVSFIAFKP 280 YP A+VRIIGFDN+RQVQC+SFIA P Sbjct: 151 YPQAFVRIIGFDNVRQVQCISFIAHTP 177
>RBS2_PEA (P00869) Ribulose bisphosphate carboxylase small chain 3C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3C) (PSS15) Length = 180 Score = 49.7 bits (117), Expect = 2e-06 Identities = 21/27 (77%), Positives = 24/27 (88%) Frame = -3 Query: 360 YPDAYVRIIGFDNMRQVQCVSFIAFKP 280 YP A+VRIIGFDN+RQVQC+SFIA P Sbjct: 151 YPQAFVRIIGFDNVRQVQCISFIAHTP 177
>RBS1_PEA (P00868) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) (PSSU1) (Fragment) Length = 136 Score = 48.1 bits (113), Expect = 5e-06 Identities = 19/27 (70%), Positives = 25/27 (92%) Frame = -3 Query: 360 YPDAYVRIIGFDNMRQVQCVSFIAFKP 280 YP+A+VR+IGF+N+RQVQC+SFIA P Sbjct: 107 YPEAFVRVIGFNNVRQVQCISFIAHTP 133
>RBS_SYNP2 (Q44178) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 111 Score = 46.2 bits (108), Expect = 2e-05 Identities = 17/30 (56%), Positives = 24/30 (80%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 280 + EY D Y+R++GFDN++Q Q VSFI +KP Sbjct: 77 RSEYSDCYIRVVGFDNIKQCQTVSFIVYKP 106
>RBS_PROHO (P27569) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 109 Score = 45.4 bits (106), Expect = 3e-05 Identities = 17/30 (56%), Positives = 24/30 (80%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 280 + EYP+ Y+R++GFDN++Q Q VSFI KP Sbjct: 77 RTEYPNCYIRVVGFDNIKQCQSVSFIVHKP 106
>RBS_SYNY3 (P54206) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 113 Score = 42.7 bits (99), Expect = 2e-04 Identities = 17/30 (56%), Positives = 23/30 (76%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 280 + E P+ Y+R+IGFDN++Q Q VSFI KP Sbjct: 77 RSENPNCYIRVIGFDNIKQCQTVSFIVHKP 106
>RBS_CYAPA (P18062) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 106 Score = 42.7 bits (99), Expect = 2e-04 Identities = 14/30 (46%), Positives = 26/30 (86%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 280 K+++P+AY+R++ FD++RQVQ + F+ +KP Sbjct: 76 KQQFPNAYIRVVAFDSIRQVQTLMFLVYKP 105
>RBS_ANASP (P06514) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 109 Score = 42.0 bits (97), Expect = 4e-04 Identities = 15/30 (50%), Positives = 23/30 (76%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 280 + +YP Y+R++GFDN++Q Q +SFI KP Sbjct: 77 RSQYPGHYIRVVGFDNIKQCQILSFIVHKP 106
>RBS_SYNP6 (P04716) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 110 Score = 41.6 bits (96), Expect = 5e-04 Identities = 16/30 (53%), Positives = 22/30 (73%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 280 + EY D Y+R+ GFDN++Q Q VSFI +P Sbjct: 78 RSEYGDCYIRVAGFDNIKQCQTVSFIVHRP 107
>RBS2_CHLRE (P08475) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 185 Score = 40.8 bits (94), Expect = 8e-04 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = -3 Query: 366 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 265 K +PDAYVR++ FDN +QVQ + F+ +P + Sbjct: 143 KAFPDAYVRLVAFDNQKQVQIMGFLVQRPKSARD 176
>RBS1_CHLRE (P00873) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 185 Score = 40.4 bits (93), Expect = 0.001 Identities = 15/29 (51%), Positives = 22/29 (75%) Frame = -3 Query: 366 KEYPDAYVRIIGFDNMRQVQCVSFIAFKP 280 K +PDAYVR++ FDN +QVQ + F+ +P Sbjct: 143 KAFPDAYVRLVAFDNQKQVQIMGFLVQRP 171
>RBS_EUGGR (P16881) Ribulose bisphosphate carboxylase small chains, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunits) [Contains: Ribulose bisphosphate carboxylase small chain P1; Ribulose bisphosphate carboxylase small chain P2; Ribulose bispho Length = 1273 Score = 40.4 bits (93), Expect = 0.001 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEES 262 ++ YP YVR+ FD+++QVQ +SF+ +P G S Sbjct: 1093 RRAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 1128 Score = 40.4 bits (93), Expect = 0.001 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEES 262 ++ YP YVR+ FD+++QVQ +SF+ +P G S Sbjct: 805 RRAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 840 Score = 40.4 bits (93), Expect = 0.001 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEES 262 ++ YP YVR+ FD+++QVQ +SF+ +P G S Sbjct: 662 RRAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 697 Score = 40.4 bits (93), Expect = 0.001 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEES 262 ++ YP YVR+ FD+++QVQ +SF+ +P G S Sbjct: 518 RRAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 553 Score = 40.4 bits (93), Expect = 0.001 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEES 262 ++ YP YVR+ FD+++QVQ +SF+ +P G S Sbjct: 375 RRAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 410 Score = 40.4 bits (93), Expect = 0.001 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEES 262 ++ YP YVR+ FD+++QVQ +SF+ +P G S Sbjct: 231 RRAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 266 Score = 37.4 bits (85), Expect = 0.009 Identities = 13/30 (43%), Positives = 22/30 (73%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 280 ++ YP YVR+ FD+++QVQ +SF+ +P Sbjct: 1237 RRAYPQCYVRLAAFDSVKQVQVISFVVQRP 1266 Score = 36.2 bits (82), Expect = 0.020 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEES 262 ++ YP YVR+ FD+++QVQ +SF+ +P G S Sbjct: 950 RRAYPQCYVRL-AFDSVKQVQVISFVVQRPSGSSSS 984
>RBS_CHLMO (P17537) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 168 Score = 40.0 bits (92), Expect = 0.001 Identities = 13/32 (40%), Positives = 23/32 (71%) Frame = -3 Query: 360 YPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 265 +P+ Y+R++ FDN++QVQC+ F+ +P E Sbjct: 128 FPNVYIRLVAFDNVKQVQCMGFLVQRPRNAAE 159
>RBS7_ACECL (Q38693) Ribulose bisphosphate carboxylase small chain 7,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 7) (rbcS1) Length = 183 Score = 39.3 bits (90), Expect = 0.002 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = -3 Query: 366 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 265 K +PDAY+R++ FD RQVQ F+ +PP + Sbjct: 141 KAFPDAYIRLVCFDANRQVQICGFLVHRPPSATD 174
>RBS6_ACECL (Q38692) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) (rbcS4) Length = 182 Score = 38.9 bits (89), Expect = 0.003 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = -3 Query: 366 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 265 K +PDAY+R++ FD RQVQ F+ +PP + Sbjct: 140 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS4_ACECL (P16132) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 182 Score = 38.9 bits (89), Expect = 0.003 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = -3 Query: 366 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 265 K +PDAY+R++ FD RQVQ F+ +PP + Sbjct: 140 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS3_ACEME (P16136) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 182 Score = 38.9 bits (89), Expect = 0.003 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = -3 Query: 366 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 265 K +PDAY+R++ FD RQVQ F+ +PP + Sbjct: 140 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS1_ACEME (P16134) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 182 Score = 38.9 bits (89), Expect = 0.003 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = -3 Query: 366 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 265 K +PDAY+R++ FD RQVQ F+ +PP + Sbjct: 140 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS2_ACECL (P16130) Ribulose bisphosphate carboxylase small chain 2 (EC| 4.1.1.39) (RuBisCO small subunit 2) (Fragment) Length = 86 Score = 38.9 bits (89), Expect = 0.003 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = -3 Query: 366 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 265 K +PDAY+R++ FD RQVQ F+ +PP + Sbjct: 44 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 77
>RBS1_ACECL (P16129) Ribulose bisphosphate carboxylase small chain 1 (EC| 4.1.1.39) (RuBisCO small subunit 1) (Fragment) Length = 126 Score = 38.9 bits (89), Expect = 0.003 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = -3 Query: 366 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 265 K +PDAY+R++ FD RQVQ F+ +PP + Sbjct: 84 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 117
>RBS2_ACEME (P16135) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) (Fragment) Length = 173 Score = 38.9 bits (89), Expect = 0.003 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = -3 Query: 366 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 265 K +PDAY+R++ FD RQVQ F+ +PP + Sbjct: 131 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 164
>RBS3_ACECL (P16131) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 183 Score = 38.9 bits (89), Expect = 0.003 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = -3 Query: 366 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 265 K +PDAY+R++ FD RQVQ F+ +PP + Sbjct: 141 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 174
>RBS_MARPA (O64416) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 38.5 bits (88), Expect = 0.004 Identities = 15/23 (65%), Positives = 18/23 (78%) Frame = -3 Query: 348 YVRIIGFDNMRQVQCVSFIAFKP 280 Y+R +GFDN RQVQC SFI +P Sbjct: 156 YIRCLGFDNTRQVQCASFIVHQP 178
>RBS5_ACECL (P16133) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 184 Score = 38.5 bits (88), Expect = 0.004 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = -3 Query: 366 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPP 277 K +PDAY+R++ FD RQVQ F+ +PP Sbjct: 142 KAFPDAYIRLVCFDANRQVQISGFLVHRPP 171
>RBS5_ACEME (P16138) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 183 Score = 37.4 bits (85), Expect = 0.009 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = -3 Query: 360 YPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 265 +PDAY+R++ FD RQVQ F+ +PP + Sbjct: 143 FPDAYIRLVCFDANRQVQISGFLVHRPPSATD 174
>RBS4_ACEME (P16137) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 182 Score = 37.4 bits (85), Expect = 0.009 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = -3 Query: 360 YPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 265 +PDAY+R++ FD RQVQ F+ +PP + Sbjct: 142 FPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS_SACHY (Q41373) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 168 Score = 37.4 bits (85), Expect = 0.009 Identities = 17/31 (54%), Positives = 23/31 (74%) Frame = -3 Query: 360 YPDAYVRIIGFDNMRQVQCVSFIAFKPPGCE 268 YP+ I+GFDN+RQ Q ++FIA+KP G E Sbjct: 139 YPELRA-ILGFDNIRQTQWLTFIAYKPAGSE 168
>RBS_BATOE (P26985) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 175 Score = 35.8 bits (81), Expect = 0.026 Identities = 14/29 (48%), Positives = 20/29 (68%) Frame = -3 Query: 366 KEYPDAYVRIIGFDNMRQVQCVSFIAFKP 280 K +PDAY+R++ FD RQVQ F+ +P Sbjct: 133 KAFPDAYIRLVCFDANRQVQISGFLVHRP 161
>RBS2_CHRVI (P22860) Ribulose bisphosphate carboxylase small chain 2 (EC| 4.1.1.39) (RuBisCO small subunit 2) Length = 113 Score = 32.7 bits (73), Expect = 0.22 Identities = 12/30 (40%), Positives = 21/30 (70%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 280 ++ YPD +VR++G+D Q + SF+A +P Sbjct: 83 RRSYPDHHVRLVGYDTYAQSKGHSFLAHRP 112
>MURB_STAHJ (Q4L4G3) UDP-N-acetylenolpyruvoylglucosamine reductase (EC| 1.1.1.158) (UDP-N-acetylmuramate dehydrogenase) Length = 307 Score = 32.7 bits (73), Expect = 0.22 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 4/44 (9%) Frame = -3 Query: 132 AHVHVPTWLEKACSYVNAIGGYVY----AHAHNIIQSVDYVICI 13 A HV T LE AC ++GG VY A+ I +DY +C+ Sbjct: 115 ARDHVLTGLEFACGIPGSVGGAVYMNAGAYGGEIKDCIDYALCV 158
>RBS_PSEHY (Q51857) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 124 Score = 31.6 bits (70), Expect = 0.49 Identities = 10/30 (33%), Positives = 21/30 (70%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 280 K+ P+ +++IG+DN+RQ Q + + ++P Sbjct: 93 KRSNPNHLIKLIGYDNIRQTQGTAMLVYRP 122
>MURB_STAES (Q8CPZ7) UDP-N-acetylenolpyruvoylglucosamine reductase (EC| 1.1.1.158) (UDP-N-acetylmuramate dehydrogenase) Length = 306 Score = 31.2 bits (69), Expect = 0.64 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 4/44 (9%) Frame = -3 Query: 132 AHVHVPTWLEKACSYVNAIGGYVY----AHAHNIIQSVDYVICI 13 A HV T LE AC +IGG V+ A+ + +DY +C+ Sbjct: 114 ARDHVLTGLEFACGIPGSIGGAVFMNAGAYGGEVKDCIDYALCV 157
>MURB_STAEQ (Q5HQZ1) UDP-N-acetylenolpyruvoylglucosamine reductase (EC| 1.1.1.158) (UDP-N-acetylmuramate dehydrogenase) Length = 306 Score = 31.2 bits (69), Expect = 0.64 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 4/44 (9%) Frame = -3 Query: 132 AHVHVPTWLEKACSYVNAIGGYVY----AHAHNIIQSVDYVICI 13 A HV T LE AC +IGG V+ A+ + +DY +C+ Sbjct: 114 ARDHVLTGLEFACGIPGSIGGAVFMNAGAYGGEVKDCIDYALCV 157
>RBS_SYNPX (P0A4S5) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 113 Score = 30.8 bits (68), Expect = 0.84 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -3 Query: 366 KEYPDAYVRIIGFDNMRQVQCVSFIAFK 283 + YPD +VRI+G+D Q Q F+ F+ Sbjct: 84 RAYPDHHVRIVGYDAYTQSQGACFVVFE 111
>RBS_SYNPW (P0A4S6) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 113 Score = 30.8 bits (68), Expect = 0.84 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -3 Query: 366 KEYPDAYVRIIGFDNMRQVQCVSFIAFK 283 + YPD +VRI+G+D Q Q F+ F+ Sbjct: 84 RAYPDHHVRIVGYDAYTQSQGACFVVFE 111
>RBS_ALVHS (P24682) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 121 Score = 30.8 bits (68), Expect = 0.84 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -3 Query: 366 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPP 277 K +P +VR+IG+DN Q Q + + F+ P Sbjct: 87 KAHPSHHVRLIGYDNYAQSQGTAMVIFRGP 116
>RBS_NITVU (Q59614) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 108 Score = 30.4 bits (67), Expect = 1.1 Identities = 10/28 (35%), Positives = 19/28 (67%) Frame = -3 Query: 366 KEYPDAYVRIIGFDNMRQVQCVSFIAFK 283 +E+PD VR + +DN Q Q ++F+ ++ Sbjct: 81 REFPDQMVRFVAYDNYAQSQGMAFVVYR 108
>RNFF_RHOCA (Q52718) Nitrogen fixation protein rnfF| Length = 523 Score = 30.0 bits (66), Expect = 1.4 Identities = 20/84 (23%), Positives = 34/84 (40%), Gaps = 5/84 (5%) Frame = -1 Query: 362 STLTRMSASSDSTTCVRCXXXXXXXXXXXXXXXXXXHKQLTDDG-----PHIKCHCSFVN 198 S L+ A SD+ C ++TDDG P ++ V Sbjct: 440 SVLSDNGALSDAAATALCVAGEEDWPRIAAQMGVRAVLRITDDGSIFATPEMRARLEAVE 499 Query: 197 SDIALGFPSPLSFLFVPKNVCMPM 126 GFP+P++ + +PK+V +P+ Sbjct: 500 G----GFPAPITVVDLPKDVAIPL 519
>US27_HCMVA (P09703) G-protein coupled receptor homolog US27 (HHRF2)| Length = 362 Score = 30.0 bits (66), Expect = 1.4 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = +1 Query: 31 DRLYNIMCMCIYIATDSIHIRACFLEPCWYMNMGIHTFLGTNKK 162 D L N++ C+Y+ ++RAC +N GI+ +GT + Sbjct: 266 DTLQNVIIFCLYVGQFLAYVRAC-------LNPGIYILVGTQMR 302
>RBS_GUITH (P14960) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 139 Score = 30.0 bits (66), Expect = 1.4 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQ--CVSFIAFKPPGCE 268 +K P YV++ FDN R V+ C+SFI +P E Sbjct: 72 RKAKPACYVKVNAFDNSRGVESCCLSFIVQRPTSNE 107
>RBS2_THIFE (Q07088) Ribulose bisphosphate carboxylase small chain 2 (EC| 4.1.1.39) (RuBisCO small subunit 2) Length = 118 Score = 29.6 bits (65), Expect = 1.9 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = -3 Query: 366 KEYPDAYVRIIGFDNMRQVQCVSFIAFK 283 K P +VRI+G+DN +Q Q S + ++ Sbjct: 87 KRNPHNHVRIVGYDNFKQSQGTSLVVYR 114
>RBS_PORAE (Q09125) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 138 Score = 29.3 bits (64), Expect = 2.4 Identities = 13/32 (40%), Positives = 21/32 (65%), Gaps = 2/32 (6%) Frame = -3 Query: 369 KKEYPDAYVRIIGFDNMRQVQ--CVSFIAFKP 280 +K P+ Y+++ FDN R V+ C+SFI +P Sbjct: 72 RKAKPNYYIKVNAFDNTRGVESCCLSFIINRP 103
>MURB_STAAW (P61432) UDP-N-acetylenolpyruvoylglucosamine reductase (EC| 1.1.1.158) (UDP-N-acetylmuramate dehydrogenase) Length = 307 Score = 28.9 bits (63), Expect = 3.2 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 4/38 (10%) Frame = -3 Query: 114 TWLEKACSYVNAIGGYVY----AHAHNIIQSVDYVICI 13 T LE AC +IGG VY A+ + +DY +C+ Sbjct: 120 TGLEFACGIPGSIGGAVYMNAGAYGGEVKDCIDYALCV 157
>MURB_STAAU (P61431) UDP-N-acetylenolpyruvoylglucosamine reductase (EC| 1.1.1.158) (UDP-N-acetylmuramate dehydrogenase) Length = 307 Score = 28.9 bits (63), Expect = 3.2 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 4/38 (10%) Frame = -3 Query: 114 TWLEKACSYVNAIGGYVY----AHAHNIIQSVDYVICI 13 T LE AC +IGG VY A+ + +DY +C+ Sbjct: 120 TGLEFACGIPGSIGGAVYMNAGAYGGEVKDCIDYALCV 157
>MURB_STAAS (Q6GB92) UDP-N-acetylenolpyruvoylglucosamine reductase (EC| 1.1.1.158) (UDP-N-acetylmuramate dehydrogenase) Length = 307 Score = 28.9 bits (63), Expect = 3.2 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 4/38 (10%) Frame = -3 Query: 114 TWLEKACSYVNAIGGYVY----AHAHNIIQSVDYVICI 13 T LE AC +IGG VY A+ + +DY +C+ Sbjct: 120 TGLEFACGIPGSIGGAVYMNAGAYGGEVKDCIDYALCV 157
>MURB_STAAR (Q6GIQ3) UDP-N-acetylenolpyruvoylglucosamine reductase (EC| 1.1.1.158) (UDP-N-acetylmuramate dehydrogenase) Length = 307 Score = 28.9 bits (63), Expect = 3.2 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 4/38 (10%) Frame = -3 Query: 114 TWLEKACSYVNAIGGYVY----AHAHNIIQSVDYVICI 13 T LE AC +IGG VY A+ + +DY +C+ Sbjct: 120 TGLEFACGIPGSIGGAVYMNAGAYGGEVKDCIDYALCV 157
>MURB_STAAN (P65463) UDP-N-acetylenolpyruvoylglucosamine reductase (EC| 1.1.1.158) (UDP-N-acetylmuramate dehydrogenase) Length = 307 Score = 28.9 bits (63), Expect = 3.2 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 4/38 (10%) Frame = -3 Query: 114 TWLEKACSYVNAIGGYVY----AHAHNIIQSVDYVICI 13 T LE AC +IGG VY A+ + +DY +C+ Sbjct: 120 TGLEFACGIPGSIGGAVYMNAGAYGGEVKDCIDYALCV 157
>MURB_STAAM (P65462) UDP-N-acetylenolpyruvoylglucosamine reductase (EC| 1.1.1.158) (UDP-N-acetylmuramate dehydrogenase) Length = 307 Score = 28.9 bits (63), Expect = 3.2 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 4/38 (10%) Frame = -3 Query: 114 TWLEKACSYVNAIGGYVY----AHAHNIIQSVDYVICI 13 T LE AC +IGG VY A+ + +DY +C+ Sbjct: 120 TGLEFACGIPGSIGGAVYMNAGAYGGEVKDCIDYALCV 157
>MURB_STAAC (Q5HHT2) UDP-N-acetylenolpyruvoylglucosamine reductase (EC| 1.1.1.158) (UDP-N-acetylmuramate dehydrogenase) Length = 307 Score = 28.9 bits (63), Expect = 3.2 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 4/38 (10%) Frame = -3 Query: 114 TWLEKACSYVNAIGGYVY----AHAHNIIQSVDYVICI 13 T LE AC +IGG VY A+ + +DY +C+ Sbjct: 120 TGLEFACGIPGSIGGAVYMNAGAYGGEVKDCIDYALCV 157
>MURB_STAS1 (Q49VT7) UDP-N-acetylenolpyruvoylglucosamine reductase (EC| 1.1.1.158) (UDP-N-acetylmuramate dehydrogenase) Length = 308 Score = 28.5 bits (62), Expect = 4.1 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Frame = -3 Query: 132 AHVHVPTWLEKACSYVNAIGGYVY----AHAHNIIQSVDYVICI 13 A H T LE AC +IGG V+ A+ + +DY +C+ Sbjct: 114 ARDHGLTGLEFACGIPGSIGGAVFMNAGAYGGEVKDCIDYALCV 157
>ACOT1_MOUSE (O55137) Acyl-coenzyme A thioesterase 1 (EC 3.1.2.2) (Acyl-CoA| thioesterase 1) (Inducible cytosolic acyl-coenzyme A thioester hydrolase) (Long chain acyl-CoA thioester hydrolase) (Long chain acyl-CoA hydrolase) (CTE-I) Length = 419 Score = 28.5 bits (62), Expect = 4.1 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Frame = +1 Query: 100 FLEPCWY--MNMGIHTFLGTNKKDNGEGKPKAMSELTKLQ 213 ++EP ++ + G+H +G N GE KP AM++L Q Sbjct: 359 YIEPPYFPLCSAGMHLLVGANITFGGEPKPHAMAQLDAWQ 398
>MAN2_DROME (Q24451) Alpha-mannosidase 2 (EC 3.2.1.114) (Alpha-mannosidase II)| (Mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase) (MAN II) (Golgi alpha-mannosidase II) (AMAN II) Length = 1108 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = -1 Query: 248 QLTDDGPHIKCHCSFVNSDIALGFPSPLSFLFVPKNVCMPMFMYQ 114 QLT D PH+ H F+ + ++LF+P P+ + Q Sbjct: 761 QLTQDSPHVPVHFKFLKYGVRSHGDRSGAYLFLPNGPASPVELGQ 805
>RBS2_HYDMR (Q59461) Ribulose bisphosphate carboxylase small chain 2 (EC| 4.1.1.39) (RuBisCO small subunit 2) Length = 122 Score = 28.1 bits (61), Expect = 5.4 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = -3 Query: 360 YPDAYVRIIGFDNMRQVQCVSFIAFKPPG-CEESG 259 YP+ +R+IG+DN Q Q +F F G C G Sbjct: 84 YPNHMIRLIGYDNYTQCQGHNFCRFTVLGECNSHG 118
>RBS1_CHRVI (P22850) Ribulose bisphosphate carboxylase small chain 1 (EC| 4.1.1.39) (RuBisCO small subunit 1) Length = 117 Score = 27.7 bits (60), Expect = 7.1 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -3 Query: 366 KEYPDAYVRIIGFDNMRQVQCVSFIAFK 283 K +P+ +VR+IGFDN Q + + ++ Sbjct: 86 KAHPNNHVRLIGFDNYAQSKGAEMVVYR 113
>AMP1A_ARATH (Q9SLN5) Methionine aminopeptidase 1A (EC 3.4.11.18) (MetAP 1A)| (MAP 1A) (Peptidase M 1A) Length = 398 Score = 27.7 bits (60), Expect = 7.1 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -1 Query: 182 GFPSPLSFLFVPKNVC 135 G+PSPL++ F PK+ C Sbjct: 190 GYPSPLNYYFFPKSCC 205
>YHFA_SCHPO (O74751) Hypothetical protein C1734.10c in chromosome II| Length = 332 Score = 27.3 bits (59), Expect = 9.2 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 233 GPHIKCHCSFVNSDIAL 183 GP+ K HCSF N+++ L Sbjct: 164 GPNFKLHCSFCNAELGL 180 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,131,775 Number of Sequences: 219361 Number of extensions: 905217 Number of successful extensions: 2167 Number of sequences better than 10.0: 141 Number of HSP's better than 10.0 without gapping: 2102 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2165 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 1407308304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)