| Clone Name | rbags20l19 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RIN1_RAT (P97680) Ras and Rab interactor 1 (Ras interaction/inte... | 32 | 1.6 | 2 | FOXM1_MOUSE (O08696) Forkhead box protein M1 (Forkhead homolog 1... | 30 | 5.9 |
|---|
>RIN1_RAT (P97680) Ras and Rab interactor 1 (Ras interaction/interference| protein 1) Length = 774 Score = 32.0 bits (71), Expect = 1.6 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = +2 Query: 212 QQHTTTPKSKLIHKKSGTGYSIYRHGQRPSDFEVETKRKPSEASQ*NN 355 Q + P L+H+ TGY IYR +RP ET+R +E ++ N Sbjct: 679 QGYHRLPPEALVHRLPTTGYLIYRRAERP-----ETQRAATEKTKTGN 721
>FOXM1_MOUSE (O08696) Forkhead box protein M1 (Forkhead homolog 16)| (Winged-helix transcription factor Trident) Length = 760 Score = 30.0 bits (66), Expect = 5.9 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = -1 Query: 457 PCPLYNTNPY*LASLPFGK--RSHQRRARGGVPRVMIVSLAGFRWFSFGLDLE 305 P L N+ P+ LAS PFG H + G P + I SL+ R + GL L+ Sbjct: 670 PRELLNSEPFDLASDPFGSPPPPHVEGPKPGSPELQIPSLSANRSLTEGLVLD 722 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 98,411,876 Number of Sequences: 219361 Number of extensions: 2088124 Number of successful extensions: 5975 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5811 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5973 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5824436538 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)