| Clone Name | rbags20h24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SIM2_HUMAN (Q14190) Single-minded homolog 2 | 33 | 0.60 | 2 | SYM_BACTN (Q8A3M1) Methionyl-tRNA synthetase (EC 6.1.1.10) (Meth... | 30 | 6.6 | 3 | SIM2_MOUSE (Q61079) Single-minded homolog 2 (SIM transcription f... | 30 | 6.6 |
|---|
>SIM2_HUMAN (Q14190) Single-minded homolog 2| Length = 667 Score = 33.1 bits (74), Expect = 0.60 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 4/60 (6%) Frame = +1 Query: 94 CGLFHIIFIHQLGKGKRRKTAXHFNLLGSNRCSYNWVEFSA----KS*GSPPHCATGLEY 261 C +FH+ + H L K + T ++ LL S R + WV+ A S S PHC + Y Sbjct: 272 CDVFHLRYAHHLLLVKGQVTTKYYRLL-SKRGGWVWVQSYATVVHNSRSSRPHCIVSVNY 330
>SYM_BACTN (Q8A3M1) Methionyl-tRNA synthetase (EC 6.1.1.10) (Methionine--tRNA| ligase) (MetRS) Length = 679 Score = 29.6 bits (65), Expect = 6.6 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = -3 Query: 579 NEFYDITEEPVLPGRHFCSFPSRESHVGTTRHCQRIPK 466 NE + P+ P F F + VGT CQ++PK Sbjct: 560 NEEANYKANPIRPNIEFDDFTKLDIRVGTILECQKVPK 597
>SIM2_MOUSE (Q61079) Single-minded homolog 2 (SIM transcription factor) (mSIM)| Length = 657 Score = 29.6 bits (65), Expect = 6.6 Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 4/60 (6%) Frame = +1 Query: 94 CGLFHIIFIHQLGKGKRRKTAXHFNLLGSNRCSYNWVEFSA----KS*GSPPHCATGLEY 261 C FH+ + H L K + T ++ LL S + WV+ A S S PHC + Y Sbjct: 272 CDTFHLRYAHHLLLVKGQVTTKYYRLL-SKLGGWVWVQSYATVVHNSRSSRPHCIVSVNY 330 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 82,022,776 Number of Sequences: 219361 Number of extensions: 1609485 Number of successful extensions: 3531 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3460 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3531 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4986986160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)