| Clone Name | rbags20g15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LIN3_CAEEL (Q03345) Protein lin-3 precursor (Abnormal cell linea... | 33 | 0.91 | 2 | AMP_IMPBA (O24006) Antimicrobial peptides precursor (IB-AMP) [Co... | 32 | 2.6 | 3 | YR75_CAEEL (Q09394) Hypothetical protein F43C1.5 | 30 | 5.9 | 4 | DML2_ARATH (Q9SR66) DEMETER-like protein 2 | 30 | 5.9 | 5 | COR2A_MOUSE (Q8C0P5) Coronin-2A | 30 | 7.7 | 6 | SPP41_YEAST (P38904) Protein SPP41 | 30 | 7.7 | 7 | COR2A_HUMAN (Q92828) Coronin-2A (WD repeat-containing protein 2)... | 30 | 7.7 |
|---|
>LIN3_CAEEL (Q03345) Protein lin-3 precursor (Abnormal cell lineage protein 3)| (Lethal protein 94) Length = 438 Score = 33.1 bits (74), Expect = 0.91 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Frame = -1 Query: 662 EDQMVEHKEEESCSGKDDVAQKSKN---PHAKKENSKTKECSCGSARKHKASC 513 ED+ V+ + EE+ +D Q + + P +KE K KE C H A+C Sbjct: 112 EDEKVDEEVEEALKYNEDATQDATSTLKPAVRKEIEKLKEAKCKDYCHHNATC 164
>AMP_IMPBA (O24006) Antimicrobial peptides precursor (IB-AMP) [Contains: Basic| peptide AMP3 (IB-AMP3); Basic peptide AMP1-1 (IB-AMP1-1); Basic peptide AMP1-2 (IB-AMP1-2); Basic peptide AMP1-3 (IB-AMP1-3); Basic peptide AMP2 (IB-AMP2); Basic peptide AMP4 ( Length = 333 Score = 31.6 bits (70), Expect = 2.6 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = -1 Query: 641 KEEESCSGKDDVAQKSKNPHAKKENSKTKECSCGSARKH-KASCSLATAAPSREP 480 KEEE D+V+ KS P ++ + + C+ G RK+ K C+ A A + P Sbjct: 31 KEEEPAKKPDEVSVKSGGPEVSEDQYRHRCCAWGPGRKYCKRWCANAEEAAAAIP 85
>YR75_CAEEL (Q09394) Hypothetical protein F43C1.5| Length = 221 Score = 30.4 bits (67), Expect = 5.9 Identities = 14/55 (25%), Positives = 28/55 (50%) Frame = -1 Query: 692 MSLSLAHPQNEDQMVEHKEEESCSGKDDVAQKSKNPHAKKENSKTKECSCGSARK 528 ++L L H + + E K+++SCS + + ++ +NSK + S A+K Sbjct: 116 LALLLEHREVNTLISEEKKKKSCSDSSSIQESRRHVKIPGKNSKNSKISVNKAKK 170
>DML2_ARATH (Q9SR66) DEMETER-like protein 2| Length = 1309 Score = 30.4 bits (67), Expect = 5.9 Identities = 15/63 (23%), Positives = 31/63 (49%) Frame = -1 Query: 677 AHPQNEDQMVEHKEEESCSGKDDVAQKSKNPHAKKENSKTKECSCGSARKHKASCSLATA 498 +H Q+ + ++ ++++ + +DV + K P K K+KE + + +K SL Sbjct: 738 SHQQDPESTIQTQDQQESTRTEDVKKNRKKPTTSKPKKKSKESAKSTQKKSVDWDSLRKE 797 Query: 497 APS 489 A S Sbjct: 798 AES 800
>COR2A_MOUSE (Q8C0P5) Coronin-2A| Length = 524 Score = 30.0 bits (66), Expect = 7.7 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +2 Query: 77 VSPMEISVVCECRPFADIIVAPIHPTARISDHRSKLSVSNG 199 V+P I+VV EC +V P+H T ++ H K+ G Sbjct: 43 VNPHFIAVVTECAGGGAFLVIPLHQTGKLDPHYPKVCGHRG 83
>SPP41_YEAST (P38904) Protein SPP41| Length = 1435 Score = 30.0 bits (66), Expect = 7.7 Identities = 15/52 (28%), Positives = 26/52 (50%) Frame = -1 Query: 665 NEDQMVEHKEEESCSGKDDVAQKSKNPHAKKENSKTKECSCGSARKHKASCS 510 NE++ E ++ E + D ++ K + KK+ SK +E S + K S S Sbjct: 190 NEEEEKEPEKHEHAAPNDKLSSKKSSKKKKKDKSKNRESSKDKSSKKSKSSS 241
>COR2A_HUMAN (Q92828) Coronin-2A (WD repeat-containing protein 2) (IR10)| Length = 525 Score = 30.0 bits (66), Expect = 7.7 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +2 Query: 77 VSPMEISVVCECRPFADIIVAPIHPTARISDHRSKLSVSNG 199 V+P I+VV EC +V P+H T ++ H K+ G Sbjct: 43 VNPHFIAVVTECAGGGAFLVIPLHQTGKLDPHYPKVCGHRG 83 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 98,416,367 Number of Sequences: 219361 Number of extensions: 1918688 Number of successful extensions: 5607 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 5384 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5593 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7592921998 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)