| Clone Name | rbags20f22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YJIR_ECOLI (P39389) Hypothetical protein yjiR | 30 | 4.2 | 2 | M310_ARATH (P93295) Hypothetical mitochondrial protein AtMg00310... | 29 | 9.4 | 3 | FABH_FUSNN (Q8RGX7) 3-oxoacyl-[acyl-carrier-protein] synthase 3 ... | 29 | 9.4 |
|---|
>YJIR_ECOLI (P39389) Hypothetical protein yjiR| Length = 470 Score = 30.4 bits (67), Expect = 4.2 Identities = 18/70 (25%), Positives = 31/70 (44%), Gaps = 11/70 (15%) Frame = +2 Query: 299 LRPGWRQCGKQHDDYMKCNLIITT-----------TWIVHGHYLEHSK*FKIIY*DSKIF 445 LR GW G+ HD M I++ T+++ GHY H + + IY + Sbjct: 319 LRVGWVAPGRYHDKLMHMKYAISSFNVPSTQMAAATFVLEGHYHRHIRRMRQIYQRNLAL 378 Query: 446 NDDYLKLHFP 475 +++ +FP Sbjct: 379 YTCWIREYFP 388
>M310_ARATH (P93295) Hypothetical mitochondrial protein AtMg00310 (ORF154)| Length = 154 Score = 29.3 bits (64), Expect = 9.4 Identities = 25/109 (22%), Positives = 45/109 (41%), Gaps = 14/109 (12%) Frame = +2 Query: 113 FWWVIANNRLKFKWVKWDQ----------VGSHFLNVYNMYDYYPLFESCLSEATTRIVH 262 FWW N+ K WV W + +G L +N ++ L++ + RI+H Sbjct: 28 FWWSSCENKRKISWVAWQKLCKSKEDDGGLGFRDLGWFN--------QALLAKQSFRIIH 79 Query: 263 GHYHPESVI*S*LRPGWRQCGKQHDDYMKCNLIITTTW----IVHGHYL 397 P +++ LR + H M+C++ ++ I+HG L Sbjct: 80 ---QPHTLLSRLLRSRY----FPHSSMMECSVGTRPSYAWRSIIHGREL 121
>FABH_FUSNN (Q8RGX7) 3-oxoacyl-[acyl-carrier-protein] synthase 3 (EC 2.3.1.41)| (3-oxoacyl-[acyl-carrier-protein] synthase III) (Beta-ketoacyl-ACP synthase III) (KAS III) Length = 328 Score = 29.3 bits (64), Expect = 9.4 Identities = 16/61 (26%), Positives = 28/61 (45%) Frame = +3 Query: 162 GIKWVPTF*MYTTCTTIIHFLNHAYLKLQPGSYMGIITLKV*FNHNYDQVGDNAGSNTMI 341 G+K +P F + CT I+ L AY ++ G Y I+ + ++ D NT + Sbjct: 100 GLKKIPCFDLNAACTGFIYGLEVAYSLVKSGLYKNILVIGA---ETLSRIVDMQNRNTCV 156 Query: 342 I 344 + Sbjct: 157 L 157 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 88,554,327 Number of Sequences: 219361 Number of extensions: 1751134 Number of successful extensions: 3181 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3113 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3179 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5424720305 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)