| Clone Name | rbags20e11 |
|---|---|
| Clone Library Name | barley_pub |
>DHSA_ARATH (O82663) Succinate dehydrogenase [ubiquinone] flavoprotein subunit,| mitochondrial (EC 1.3.5.1) (FP) (Flavoprotein subunit of complex II) Length = 634 Score = 52.0 bits (123), Expect = 4e-07 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = -2 Query: 363 KVRXXYRPVHMNTLDXEVETFPPKARVY 280 KVR YRPVHM+TLD E++TFPPKARVY Sbjct: 607 KVRLDYRPVHMDTLDDEIDTFPPKARVY 634
>IBB_VICAN (P01065) Bowman-Birk type proteinase inhibitor (VAI)| Length = 72 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = -1 Query: 289 TCLLIRTXLPTCRLFDEGVAHSAVSCEFQ*NFRDPPFSQSFRT 161 TCL R+ PTCR D G + N+ +PP Q F T Sbjct: 11 TCLCTRSQPPTCRCVDVGERCHSACNHCVCNYSNPPQCQCFDT 53
>DHSA_RICCN (Q92J97) Succinate dehydrogenase flavoprotein subunit (EC 1.3.99.1)| Length = 596 Score = 29.6 bits (65), Expect = 1.9 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = -2 Query: 363 KVRXXYRPVHMNTLDXEVETFPPKARVY 280 KV Y+PV + TL EV PP RVY Sbjct: 569 KVVLDYKPVTLTTLTDEVTAVPPVKRVY 596
>IBBB_PEA (P56679) Seed trypsin/chymotrypsin inhibitor IVB (PSTI-IVB)| [Contains: Seed trypsin/chymotrypsin inhibitor II (PSTI II)] Length = 72 Score = 28.5 bits (62), Expect = 4.2 Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = -1 Query: 289 TCLLIRTXLPTCRLFDEG-VAHSA-VSCEFQ*NFRDPPFSQSFRT 161 TCL ++ PTCR D G HSA +SC + +PP Q F T Sbjct: 11 TCLCTKSNPPTCRCVDVGETCHSACLSCICA--YSNPPKCQCFDT 53
>IBB_VICFA (P24661) Bowman-Birk type proteinase inhibitor (FBI)| Length = 63 Score = 28.1 bits (61), Expect = 5.5 Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = -1 Query: 289 TCLLIRTXLPTCRLFDEGV-AHSAV-SCEFQ*NFRDPPFSQSFRT 161 TCL ++ PTCR D G HSA SC + + +PP Q F T Sbjct: 11 TCLCTKSEPPTCRCVDVGERCHSACNSCVCR--YSNPPKCQCFDT 53
>CSTF1_PONPY (Q5R8K2) Cleavage stimulation factor, 50 kDa subunit (CSTF 50 kDa| subunit) (CF-1 50 kDa subunit) (CstF-50) Length = 431 Score = 27.7 bits (60), Expect = 7.2 Identities = 17/52 (32%), Positives = 23/52 (44%) Frame = -1 Query: 316 RSRDFPAKGTCLLIRTXLPTCRLFDEGVAHSAVSCEFQ*NFRDPPFSQSFRT 161 RS F G +L+ T PT RL+D VSC Q D S ++ + Sbjct: 221 RSISFHPSGDFILVGTQHPTLRLYDINTFQCFVSCNPQDQHADAICSVNYNS 272
>CSTF1_HUMAN (Q05048) Cleavage stimulation factor, 50 kDa subunit (CSTF 50 kDa| subunit) (CF-1 50 kDa subunit) (CstF-50) Length = 431 Score = 27.7 bits (60), Expect = 7.2 Identities = 17/52 (32%), Positives = 23/52 (44%) Frame = -1 Query: 316 RSRDFPAKGTCLLIRTXLPTCRLFDEGVAHSAVSCEFQ*NFRDPPFSQSFRT 161 RS F G +L+ T PT RL+D VSC Q D S ++ + Sbjct: 221 RSISFHPSGDFILVGTQHPTLRLYDINTFQCFVSCNPQDQHTDAICSVNYNS 272
>CLPP_CHLEU (P42379) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) [Contains: Ceu clpP intein (Insertion IS2)] Length = 1010 Score = 27.7 bits (60), Expect = 7.2 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +1 Query: 205 GTRKTPRCELHPHQTTDTLAXMSGSVNTCLWR 300 GT T + E P DT+ + VNT LWR Sbjct: 727 GTTSTIQLEAAPSNLYDTIIGLPVEVNTTLWR 758
>DHSA_RICPR (P31038) Succinate dehydrogenase flavoprotein subunit (EC 1.3.99.1)| Length = 596 Score = 27.7 bits (60), Expect = 7.2 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -2 Query: 363 KVRXXYRPVHMNTLDXEVETFPPKARVY 280 KV Y+PV + TL + PP RVY Sbjct: 569 KVVLDYKPVTLTTLTDAISAIPPVKRVY 596
>CSTF1_RAT (Q5BJQ6) Cleavage stimulation factor, 50 kDa subunit (CSTF 50 kDa| subunit) (CF-1 50 kDa subunit) (CstF-50) Length = 431 Score = 27.3 bits (59), Expect = 9.3 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = -1 Query: 316 RSRDFPAKGTCLLIRTXLPTCRLFDEGVAHSAVSCEFQ 203 RS F G +L+ T PT RL+D VSC Q Sbjct: 221 RSISFHPSGDFILVGTQHPTLRLYDINTFQCFVSCNPQ 258
>CSTF1_MOUSE (Q99LC2) Cleavage stimulation factor, 50 kDa subunit (CSTF 50 kDa| subunit) (CF-1 50 kDa subunit) (CstF-50) Length = 431 Score = 27.3 bits (59), Expect = 9.3 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = -1 Query: 316 RSRDFPAKGTCLLIRTXLPTCRLFDEGVAHSAVSCEFQ 203 RS F G +L+ T PT RL+D VSC Q Sbjct: 221 RSISFHPSGDFILVGTQHPTLRLYDINTFQCFVSCNPQ 258
>CP4E1_DROME (Q9V4T5) Probable cytochrome P450 4e1 (EC 1.14.-.-) (CYPIVE1)| Length = 531 Score = 27.3 bits (59), Expect = 9.3 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = -3 Query: 200 KFQGPSILPKLQNCNIIGN 144 KFQGPS+LP + N + +GN Sbjct: 32 KFQGPSMLPLVGNAHQMGN 50 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,010,953 Number of Sequences: 219361 Number of extensions: 961802 Number of successful extensions: 1952 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1928 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1952 length of database: 80,573,946 effective HSP length: 97 effective length of database: 59,295,929 effective search space used: 1423102296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)