| Clone Name | rbags20c22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | COMT1_CAPCH (O81646) Caffeic acid 3-O-methyltransferase (EC 2.1.... | 30 | 6.2 | 2 | COMT1_CAPAN (Q9FQY8) Caffeic acid 3-O-methyltransferase (EC 2.1.... | 30 | 6.2 |
|---|
>COMT1_CAPCH (O81646) Caffeic acid 3-O-methyltransferase (EC 2.1.1.68)| (S-adenosysl-L-methionine:caffeic acid 3-O-methyltransferase) (COMT) (CAOMT) Length = 359 Score = 30.4 bits (67), Expect = 6.2 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +3 Query: 324 KLMFESVYHRTDTQFKGSYTLYQACDITLLIYHNTD 431 K++ ES YH TD G +A +T YH TD Sbjct: 130 KVLMESWYHLTDAVLDGGVPFNKAYGMTTFEYHGTD 165
>COMT1_CAPAN (Q9FQY8) Caffeic acid 3-O-methyltransferase (EC 2.1.1.68)| (S-adenosysl-L-methionine:caffeic acid 3-O-methyltransferase) (COMT) (CAOMT) Length = 359 Score = 30.4 bits (67), Expect = 6.2 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +3 Query: 324 KLMFESVYHRTDTQFKGSYTLYQACDITLLIYHNTD 431 K++ ES YH TD G +A +T YH TD Sbjct: 130 KVLMESWYHLTDAVLDGGVPFNKAYGMTAFEYHGTD 165 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 106,640,477 Number of Sequences: 219361 Number of extensions: 2227203 Number of successful extensions: 5409 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5244 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5408 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7932903580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)