| Clone Name | rbaak4o19 |
|---|---|
| Clone Library Name | barley_pub |
>PSL2_MOUSE (Q9JJF9) Signal peptide peptidase-like 2A (EC 3.4.23.-) (SPP-like| 2A protein) (SPPL2a protein) (Intramembrane protease 3) (IMP3) (Presenilin-like protein 2) Length = 523 Score = 61.6 bits (148), Expect = 1e-09 Identities = 34/82 (41%), Positives = 47/82 (57%) Frame = -2 Query: 537 YFLWSASAYGTGLLITYVALNLMDGHGQPALLYIVPFTLGTLISLGWKRGELRNLWLKGE 358 Y++ S AY G++IT+V L +M GQPALLY+VP TL T+ + W R E++ W KG Sbjct: 439 YYISSTIAYAVGMIITFVVLMVMKT-GQPALLYLVPCTLITVSVVAWSRKEMKKFW-KGS 496 Query: 357 PDRVCTHQGYVQMAKPPPADDE 292 +V H Y + P DE Sbjct: 497 SYQVMGHLDYSTNEENPVTTDE 518
>PSL1_CHICK (Q5F383) Signal peptide peptidase-like 2B (EC 3.4.23.-) (Protein| SPP-like 2B) (Protein SPPL2b) Length = 596 Score = 56.2 bits (134), Expect = 6e-08 Identities = 40/98 (40%), Positives = 49/98 (50%), Gaps = 9/98 (9%) Frame = -2 Query: 537 YFLWSASAYGTGLLITYVALNLMDGHGQPALLYIVPFTLGTLISLGWKRGELRNLWLKG- 361 YF+ AYG GLL+T+VAL LM GQPALLY+VP TL T S+ R EL W Sbjct: 441 YFVACTIAYGIGLLVTFVALALMQ-MGQPALLYLVPCTLITSFSVALWRKELAMFWTGSG 499 Query: 360 ------EPDRVCTHQGYVQMAKPP--PADDEDGEEAKN 271 +P V Q+ K PA ++ EE N Sbjct: 500 FAKDLPQPPLVIASVNCPQLPKDSNVPASQQETEEMAN 537
>PSL2_HUMAN (Q8TCT8) Signal peptide peptidase-like 2A (EC 3.4.23.-) (Protein| SPP-like 2A) (Protein SPPL2a) (Intramembrane protease 3) (IMP3) (Presenilin-like protein 2) Length = 520 Score = 55.8 bits (133), Expect = 8e-08 Identities = 29/67 (43%), Positives = 42/67 (62%) Frame = -2 Query: 537 YFLWSASAYGTGLLITYVALNLMDGHGQPALLYIVPFTLGTLISLGWKRGELRNLWLKGE 358 Y++ S AY G+++T+V L LM GQPALLY+VP TL T + W+R E++ W KG Sbjct: 436 YYVSSTVAYAIGMILTFVVLVLMK-KGQPALLYLVPCTLITASVVAWRRKEMKKFW-KGN 493 Query: 357 PDRVCTH 337 ++ H Sbjct: 494 SYQMMDH 500
>PSL1_HUMAN (Q8TCT7) Signal peptide peptidase-like 2B (EC 3.4.23.-) (Protein| SPP-like 2B) (Protein SPPL2b) (Intramembrane protease 4) (IMP4) (Presenilin-like protein 1) Length = 592 Score = 55.8 bits (133), Expect = 8e-08 Identities = 34/78 (43%), Positives = 43/78 (55%) Frame = -2 Query: 537 YFLWSASAYGTGLLITYVALNLMDGHGQPALLYIVPFTLGTLISLGWKRGELRNLWLKGE 358 YF+ AYG GLL+T+VAL LM GQPALLY+VP TL T ++ R EL W Sbjct: 445 YFVACTIAYGVGLLVTFVALALMQ-RGQPALLYLVPCTLVTSCAVALWRRELGVFW---- 499 Query: 357 PDRVCTHQGYVQMAKPPP 304 T G+ ++ P P Sbjct: 500 -----TGSGFAKVLPPSP 512
>PSL1_RAT (Q5PQL3) Signal peptide peptidase-like 2B (EC 3.4.23.-) (Protein| SPP-like 2B) (Protein SPPL2b) Length = 577 Score = 54.7 bits (130), Expect = 2e-07 Identities = 30/56 (53%), Positives = 37/56 (66%) Frame = -2 Query: 537 YFLWSASAYGTGLLITYVALNLMDGHGQPALLYIVPFTLGTLISLGWKRGELRNLW 370 YF+ AYG GLL+T+VAL LM HGQPALLY+VP TL T ++ R E+ W Sbjct: 438 YFVACTIAYGLGLLVTFVALVLMR-HGQPALLYLVPCTLLTSCTVALWRREMGAFW 492
>PSL1_MOUSE (Q3TD49) Signal peptide peptidase-like 2B (EC 3.4.23.-) (Protein| SPP-like 2B) (Protein SPPL2b) Length = 578 Score = 53.1 bits (126), Expect = 5e-07 Identities = 30/56 (53%), Positives = 36/56 (64%) Frame = -2 Query: 537 YFLWSASAYGTGLLITYVALNLMDGHGQPALLYIVPFTLGTLISLGWKRGELRNLW 370 YF+ AYG GLL+T+VAL LM GQPALLY+VP TL T ++ R EL W Sbjct: 438 YFVACTIAYGLGLLVTFVALVLMQ-RGQPALLYLVPCTLLTSCTVALWRRELGAFW 492
>PSL4_MOUSE (Q9CUS9) Signal peptide peptidase-like 3 (EC 3.4.23.-) (SPP-like 3| protein) (Intramembrane protease 2) (IMP2) (Presenilin-like protein 4) Length = 384 Score = 46.2 bits (108), Expect = 6e-05 Identities = 24/56 (42%), Positives = 34/56 (60%) Frame = -2 Query: 537 YFLWSASAYGTGLLITYVALNLMDGHGQPALLYIVPFTLGTLISLGWKRGELRNLW 370 YF + Y GLL VA + QPALLY+VPFTL L+++ + +G+LR +W Sbjct: 314 YFHCTLIGYFVGLLTATVASRIHRA-AQPALLYLVPFTLLPLLTMAYLKGDLRRMW 368
>PSL4_HUMAN (Q8TCT6) Signal peptide peptidase-like 3 (EC 3.4.23.-) (SPP-like 3| protein) (Intramembrane protease 2) (IMP2) (Presenilin-like protein 4) Length = 385 Score = 46.2 bits (108), Expect = 6e-05 Identities = 24/56 (42%), Positives = 34/56 (60%) Frame = -2 Query: 537 YFLWSASAYGTGLLITYVALNLMDGHGQPALLYIVPFTLGTLISLGWKRGELRNLW 370 YF + Y GLL VA + QPALLY+VPFTL L+++ + +G+LR +W Sbjct: 315 YFHCTLIGYFVGLLTATVASRIHRA-AQPALLYLVPFTLLPLLTMAYLKGDLRRMW 369
>YJ95_CAEEL (P49049) Hypothetical protein T05E11.5 in chromosome IV| Length = 468 Score = 40.0 bits (92), Expect = 0.004 Identities = 24/56 (42%), Positives = 30/56 (53%) Frame = -2 Query: 537 YFLWSASAYGTGLLITYVALNLMDGHGQPALLYIVPFTLGTLISLGWKRGELRNLW 370 YF+ + AY GL IT ++ QPALLY+VP L + L RGEL LW Sbjct: 390 YFVVTVVAYMAGLFITMAVMHHFKA-AQPALLYLVPCCLFVPLLLAVIRGELSALW 444
>HM13_MOUSE (Q9D8V0) Minor histocompatibility antigen H13 (EC 3.4.99.-) (Signal| peptide peptidase) (Presenilin-like protein 3) Length = 378 Score = 40.0 bits (92), Expect = 0.004 Identities = 27/87 (31%), Positives = 43/87 (49%) Frame = -2 Query: 537 YFLWSASAYGTGLLITYVALNLMDGHGQPALLYIVPFTLGTLISLGWKRGELRNLWLKGE 358 YF S +AY GL +T +++ H QPALLY+VP +G + + +GE+ ++ E Sbjct: 290 YFYTSFAAYIFGLGLTIFIMHIFK-HAQPALLYLVPACIGFPVLVALAKGEVAEMFSYEE 348 Query: 357 PDRVCTHQGYVQMAKPPPADDEDGEEA 277 + K P A+ E EE+ Sbjct: 349 SN-----------PKDPAAETESKEES 364
>HM13_HUMAN (Q8TCT9) Minor histocompatibility antigen H13 (EC 3.4.99.-) (Signal| peptide peptidase) (Presenilin-like protein 3) (hIMP1 protein) Length = 377 Score = 38.1 bits (87), Expect = 0.017 Identities = 20/56 (35%), Positives = 33/56 (58%) Frame = -2 Query: 537 YFLWSASAYGTGLLITYVALNLMDGHGQPALLYIVPFTLGTLISLGWKRGELRNLW 370 YF S +AY GL +T +++ H QPALLY+VP +G + + +GE+ ++ Sbjct: 290 YFYTSFAAYIFGLGLTIFIMHIFK-HAQPALLYLVPACIGFPVLVALAKGEVTEMF 344
>YKK0_YEAST (P34248) Hypothetical 67.5 kDa protein in APE1/LAP4-CWP1 intergenic| region Length = 587 Score = 32.0 bits (71), Expect = 1.2 Identities = 18/56 (32%), Positives = 30/56 (53%) Frame = -2 Query: 537 YFLWSASAYGTGLLITYVALNLMDGHGQPALLYIVPFTLGTLISLGWKRGELRNLW 370 YF+ + +Y L+ V+L++ + QPALLYIVP L + I + + + W Sbjct: 450 YFITAMVSYVASLVSAMVSLSIFNT-AQPALLYIVPSLLISTILVACWNKDFKQFW 504
>CABL1_HUMAN (Q8TDN4) CDK5 and ABL1 enzyme substrate 1 (Interactor with CDK3 1)| (Ik3-1) Length = 633 Score = 30.4 bits (67), Expect = 3.5 Identities = 17/34 (50%), Positives = 19/34 (55%) Frame = -1 Query: 424 PGHADLAGVEEGGAAEPVAQGGAGPRVHPSGLRA 323 P A+ G EEGGAA+P A G G R S L A Sbjct: 80 PQDAEWGGGEEGGAAKPGAGGACGARTRFSLLAA 113
>LMP1_EBV (P03230) Latent membrane protein 1 (LMP-1) (Protein p63) [Contains:| Protein p25] Length = 386 Score = 29.6 bits (65), Expect = 5.9 Identities = 19/47 (40%), Positives = 24/47 (51%) Frame = -2 Query: 501 LLITYVALNLMDGHGQPALLYIVPFTLGTLISLGWKRGELRNLWLKG 361 L+IT + + L + HGQ L IV F G L+ LG L LW G Sbjct: 88 LMITLLLIALWNLHGQALFLGIVLFIFGCLLVLGIWIYLLEMLWRLG 134
>Y173_LACJO (P60927) UPF0078 membrane protein LJ_0173| Length = 206 Score = 29.3 bits (64), Expect = 7.8 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = -2 Query: 537 YFLWSASAYGTGLLITYVALNLMDGHGQPALLYIVPFTLGTLISLGWKRG 388 +F W A LLI + +M P L+Y++ F++ T I+ GW++G Sbjct: 116 FFDWRAGLIA--LLIGLFLVIIMKNLTIPPLVYMLGFSIFTWINFGWEQG 163
>LMP1_EBVR (P13198) Latent membrane protein 1 (LMP-1) (Protein p63)| Length = 386 Score = 29.3 bits (64), Expect = 7.8 Identities = 19/47 (40%), Positives = 24/47 (51%) Frame = -2 Query: 501 LLITYVALNLMDGHGQPALLYIVPFTLGTLISLGWKRGELRNLWLKG 361 L+IT + + L + HGQ L IV F G L+ LG L LW G Sbjct: 88 LMITLLLIALWNLHGQALYLGIVLFIFGCLLVLGLWIYLLEILWRLG 134 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75,513,348 Number of Sequences: 219361 Number of extensions: 1509886 Number of successful extensions: 4309 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 4109 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4284 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4488201198 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)