ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbags20b21 |
|---|---|
| Clone Library Name | barley_pub |
>CANB_NEUCR (P87072) Calcineurin subunit B (Protein phosphatase 2B regulatory| subunit) (Calcineurin regulatory subunit) Length = 174 Score = 39.3 bits (90), Expect = 0.005 Identities = 15/52 (28%), Positives = 33/52 (63%) Frame = -3 Query: 446 VLRDLTGSSMSEQQREQVLTKVLEEAGYTRDSTLSLEDFVTIIDHPGLKMEV 291 VL+ + GS++ +QQ +Q++ K + EA +D +S E+F ++++ + M + Sbjct: 118 VLKMMVGSNLKDQQLQQIVDKTIMEADLDKDGKISFEEFTKMVENTDVSMSM 169
>CANB_CRYNE (Q9HDE1) Calcineurin subunit B (Protein phosphatase 2B regulatory| subunit) (Calcineurin regulatory subunit) Length = 175 Score = 35.0 bits (79), Expect = 0.086 Identities = 14/43 (32%), Positives = 27/43 (62%) Frame = -3 Query: 446 VLRDLTGSSMSEQQREQVLTKVLEEAGYTRDSTLSLEDFVTII 318 VL+ + G+++ +QQ +Q++ K + EA D LS E+F ++ Sbjct: 118 VLKQMVGNNLKDQQLQQIVDKTIMEADKDGDGKLSFEEFTQMV 160
>CHP1_RAT (P61023) Calcium-binding protein p22 (Calcium-binding protein CHP)| (Calcineurin homologous protein) Length = 194 Score = 33.9 bits (76), Expect = 0.19 Identities = 13/55 (23%), Positives = 33/55 (60%) Frame = -3 Query: 449 EVLRDLTGSSMSEQQREQVLTKVLEEAGYTRDSTLSLEDFVTIIDHPGLKMEVEV 285 +VLR + G ++S++Q + + ++EA DS +S +FV +++ ++ ++ + Sbjct: 136 QVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSI 190
>CHP1_PONPY (Q5R7F0) Calcium-binding protein p22 (Calcium-binding protein CHP)| (Calcineurin homologous protein) Length = 194 Score = 33.9 bits (76), Expect = 0.19 Identities = 13/55 (23%), Positives = 33/55 (60%) Frame = -3 Query: 449 EVLRDLTGSSMSEQQREQVLTKVLEEAGYTRDSTLSLEDFVTIIDHPGLKMEVEV 285 +VLR + G ++S++Q + + ++EA DS +S +FV +++ ++ ++ + Sbjct: 136 QVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSI 190
>CHP1_MOUSE (P61022) Calcium-binding protein p22 (Calcium-binding protein CHP)| (Calcineurin homologous protein) (Sid 470) Length = 194 Score = 33.9 bits (76), Expect = 0.19 Identities = 13/55 (23%), Positives = 33/55 (60%) Frame = -3 Query: 449 EVLRDLTGSSMSEQQREQVLTKVLEEAGYTRDSTLSLEDFVTIIDHPGLKMEVEV 285 +VLR + G ++S++Q + + ++EA DS +S +FV +++ ++ ++ + Sbjct: 136 QVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSI 190
>CHP1_HUMAN (Q99653) Calcium-binding protein p22 (Calcium-binding protein CHP)| (Calcineurin homologous protein) (Calcineurin B homolog) Length = 194 Score = 33.9 bits (76), Expect = 0.19 Identities = 13/55 (23%), Positives = 33/55 (60%) Frame = -3 Query: 449 EVLRDLTGSSMSEQQREQVLTKVLEEAGYTRDSTLSLEDFVTIIDHPGLKMEVEV 285 +VLR + G ++S++Q + + ++EA DS +S +FV +++ ++ ++ + Sbjct: 136 QVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSI 190
>PRMA_BACHK (Q6HDK9) Ribosomal protein L11 methyltransferase (EC 2.1.1.-) (L11| Mtase) Length = 312 Score = 32.3 bits (72), Expect = 0.56 Identities = 13/29 (44%), Positives = 23/29 (79%) Frame = -3 Query: 404 REQVLTKVLEEAGYTRDSTLSLEDFVTII 318 +E+V+++ LE+AG+T + L +ED+V II Sbjct: 280 KEKVISEALEKAGFTIEEVLRMEDWVAII 308
>PRMA_BACCZ (Q634M9) Ribosomal protein L11 methyltransferase (EC 2.1.1.-) (L11| Mtase) Length = 312 Score = 32.3 bits (72), Expect = 0.56 Identities = 13/29 (44%), Positives = 23/29 (79%) Frame = -3 Query: 404 REQVLTKVLEEAGYTRDSTLSLEDFVTII 318 +E+V+++ LE+AG+T + L +ED+V II Sbjct: 280 KEKVISEALEKAGFTIEEVLRMEDWVAII 308
>PRMA_BACCR (Q818F1) Ribosomal protein L11 methyltransferase (EC 2.1.1.-) (L11| Mtase) Length = 312 Score = 32.3 bits (72), Expect = 0.56 Identities = 13/29 (44%), Positives = 23/29 (79%) Frame = -3 Query: 404 REQVLTKVLEEAGYTRDSTLSLEDFVTII 318 +E+V+++ LE+AG+T + L +ED+V II Sbjct: 280 KEKVISEALEKAGFTIEEVLRMEDWVAII 308
>PRMA_BACC1 (Q730M3) Ribosomal protein L11 methyltransferase (EC 2.1.1.-) (L11| Mtase) Length = 312 Score = 32.3 bits (72), Expect = 0.56 Identities = 13/29 (44%), Positives = 23/29 (79%) Frame = -3 Query: 404 REQVLTKVLEEAGYTRDSTLSLEDFVTII 318 +E+V+++ LE+AG+T + L +ED+V II Sbjct: 280 KEKVISEALEKAGFTIEEVLRMEDWVAII 308
>PRMA_BACAN (Q81LS4) Ribosomal protein L11 methyltransferase (EC 2.1.1.-) (L11| Mtase) Length = 312 Score = 32.3 bits (72), Expect = 0.56 Identities = 13/29 (44%), Positives = 23/29 (79%) Frame = -3 Query: 404 REQVLTKVLEEAGYTRDSTLSLEDFVTII 318 +E+V+++ LE+AG+T + L +ED+V II Sbjct: 280 KEKVISEALEKAGFTIEEVLRMEDWVAII 308
>CHP1_CHICK (Q5ZM44) Calcium-binding protein p22 (Calcium-binding protein CHP)| (Calcineurin homologous protein) Length = 194 Score = 32.0 bits (71), Expect = 0.73 Identities = 12/55 (21%), Positives = 32/55 (58%) Frame = -3 Query: 449 EVLRDLTGSSMSEQQREQVLTKVLEEAGYTRDSTLSLEDFVTIIDHPGLKMEVEV 285 +VLR + G ++S++Q + + ++EA D +S +FV +++ ++ ++ + Sbjct: 136 QVLRMMVGVNISDEQLGSIADRTIQEADQDGDCAISFAEFVKVLEKVDVEQKMSI 190
>KIP3_HUMAN (Q96Q77) Calcium and integrin-binding protein 3 (Kinase-interacting| protein 3) (KIP 3) Length = 187 Score = 31.6 bits (70), Expect = 0.95 Identities = 17/44 (38%), Positives = 24/44 (54%) Frame = -3 Query: 449 EVLRDLTGSSMSEQQREQVLTKVLEEAGYTRDSTLSLEDFVTII 318 + + LT +S ++ V KVL+EA D LSLEDF +I Sbjct: 130 QTVTKLTRGGLSAEEVSLVCEKVLDEADGDHDGRLSLEDFQNMI 173
>PRMA_BACSU (P54460) Ribosomal protein L11 methyltransferase (EC 2.1.1.-) (L11| Mtase) Length = 311 Score = 31.6 bits (70), Expect = 0.95 Identities = 14/29 (48%), Positives = 23/29 (79%) Frame = -3 Query: 404 REQVLTKVLEEAGYTRDSTLSLEDFVTII 318 ++QV+ + LE+AG+T LS+ED+V+II Sbjct: 280 KKQVVKEALEQAGFTIVEILSMEDWVSII 308
>CHP2_HUMAN (O43745) Calcineurin B homologous protein 2 (Hepatocellular| carcinoma-associated antigen 520) Length = 195 Score = 30.4 bits (67), Expect = 2.1 Identities = 16/54 (29%), Positives = 30/54 (55%) Frame = -3 Query: 449 EVLRDLTGSSMSEQQREQVLTKVLEEAGYTRDSTLSLEDFVTIIDHPGLKMEVE 288 +VLR + G ++E+Q E + + ++EA D +S +F ++ KM+VE Sbjct: 137 QVLRLMVGVQVTEEQLENIADRTVQEADEDGDGAVSFVEFTKSLE----KMDVE 186
>NIN_HUMAN (Q8N4C6) Ninein (hNinein)| Length = 2090 Score = 30.4 bits (67), Expect = 2.1 Identities = 16/44 (36%), Positives = 26/44 (59%) Frame = -3 Query: 431 TGSSMSEQQREQVLTKVLEEAGYTRDSTLSLEDFVTIIDHPGLK 300 +GSS + E+ L +V E+ G TRD L+ + V+I + GL+ Sbjct: 174 SGSSPPQDWIEEKLQEVCEDLGITRDGHLNRKKLVSICEQYGLQ 217
>SAMD8_MOUSE (Q9DA37) Sphingomyelin synthase-related 1 (Sterile alpha motif| domain-containing 8) Length = 478 Score = 29.3 bits (64), Expect = 4.7 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = -3 Query: 449 EVLRDLTGSSMSEQQREQVLTKVLEEAGYTRDSTLS 342 +VL D+ +S ++ +++ T VLEE GY DS +S Sbjct: 123 KVLGDIKRLMLSVRKLQKIHTDVLEEMGYNSDSPMS 158
>YHI2_YEAST (P38763) Hypothetical 29.0 kDa protein in DED81-MYO1 intergenic| region Length = 256 Score = 28.9 bits (63), Expect = 6.2 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -3 Query: 362 TRDSTL-SLEDFVTIIDHPGLKMEVEVPI 279 T DS+L SLE ++ II H L+ E+++PI Sbjct: 159 TNDSSLASLESYICIIHHVRLECELDIPI 187
>N4BP2_HUMAN (Q86UW6) NEDD4-binding protein 2 (EC 3.-.-.-) (N4BP2) (BCL-3-binding| protein) Length = 1770 Score = 28.9 bits (63), Expect = 6.2 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 1/48 (2%) Frame = +2 Query: 80 NRRKND*TGTACIRACMWTGTQELKTMSSHSI-LSHVLLAMDTCFHQT 220 N + N+ + + AC T +Q+LKT+ S ++ S +LL+ TC QT Sbjct: 915 NDKMNEISLSTAHEACWGTSSQKLKTLGSSNLGSSEMLLSEMTCESQT 962
>LY75_HUMAN (O60449) Lymphocyte antigen 75 precursor (DEC-205) (gp200-MR6) (CD205| antigen) Length = 1722 Score = 28.5 bits (62), Expect = 8.1 Identities = 19/59 (32%), Positives = 25/59 (42%) Frame = +2 Query: 107 TACIRACMWTGTQELKTMSSHSILSHVLLAMDTCFHQT*LRACCILIC*NLHSPFTSRW 283 TA + WT +EL + H +L L + F + R C LI SPFT W Sbjct: 1017 TAYEKINKWTDNRELTYSNFHPLLVSGRLRIPENFFEEESRYHCALILNLQKSPFTGTW 1075
>NUOG_YERPE (Q8ZDL2) NADH-quinone oxidoreductase chain 3 (EC 1.6.99.5) (NADH| dehydrogenase I, chain G) (NDH-1, chain G) Length = 914 Score = 28.5 bits (62), Expect = 8.1 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -3 Query: 431 TGSSMSEQQREQVLTKVLEEAGYTRDSTLSLEDFVTII 318 TG + EQQR Q++ KVL E G + +E + ++ Sbjct: 339 TGIAAGEQQRLQLMLKVLREGGIYTPALREIESYDAVL 376
>S10A9_HUMAN (P06702) Protein S100-A9 (S100 calcium-binding protein A9)| (Calgranulin-B) (Migration inhibitory factor-related protein 14) (MRP-14) (P14) (Leukocyte L1 complex heavy chain) (Calprotectin L1H subunit) Length = 114 Score = 28.5 bits (62), Expect = 8.1 Identities = 12/43 (27%), Positives = 23/43 (53%) Frame = -3 Query: 446 VLRDLTGSSMSEQQREQVLTKVLEEAGYTRDSTLSLEDFVTII 318 V +DL E + E+V+ ++E+ D LS E+F+ ++ Sbjct: 41 VRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLM 83 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,641,664 Number of Sequences: 219361 Number of extensions: 1320828 Number of successful extensions: 3632 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 3551 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3631 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
