ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbags20b06 |
|---|---|
| Clone Library Name | barley_pub |
>OREX_RAT (O55232) Orexin precursor (Hypocretin) (Hcrt) [Contains: Orexin-A| (Hypocretin-1) (Hcrt1); Orexin-B (Hypocretin-2) (Hcrt2)] Length = 130 Score = 32.0 bits (71), Expect = 1.0 Identities = 24/61 (39%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = -2 Query: 397 GAPGRANGFQRGVRRRPGQDLLRGDVQDLRQGPGLRDG---VPGLRRRAEVEPHR-PGER 230 GA A G +RRPG L+G +Q L Q G G R AE+EP+ PG R Sbjct: 54 GAGNHAAGILTLGKRRPGPPGLQGRLQRLLQANGNHAAGILTMGRRAGAELEPYPCPGRR 113 Query: 229 C 227 C Sbjct: 114 C 114
>OREX_PIG (O77668) Orexin precursor (Hypocretin) (Hcrt) [Contains: Orexin-A| (Hypocretin-1) (Hcrt1); Orexin-B (Hypocretin-2) (Hcrt2)] Length = 131 Score = 31.6 bits (70), Expect = 1.4 Identities = 24/61 (39%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = -2 Query: 397 GAPGRANGFQRGVRRRPGQDLLRGDVQDLRQGPGLR-DGVPGLRRRAEVEPHR---PGER 230 GA A G +RRPG L+G +Q L Q G G+ + RRA EP PG R Sbjct: 55 GAGNHAAGILTLGKRRPGPPGLQGRLQRLLQASGNHAAGILTMGRRAGAEPAPRLCPGRR 114 Query: 229 C 227 C Sbjct: 115 C 115
>OREX_CANFA (Q9GLF6) Orexin precursor (Hypocretin) (Hcrt) [Contains: Orexin-A| (Hypocretin-1) (Hcrt1); Orexin-B (Hypocretin-2) (Hcrt2)] Length = 130 Score = 31.6 bits (70), Expect = 1.4 Identities = 24/61 (39%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = -2 Query: 397 GAPGRANGFQRGVRRRPGQDLLRGDVQDLRQGPGLR-DGVPGLRRRAEVEPHR---PGER 230 GA A G +RRPG L+G +Q L Q G G+ + RRA EP PG R Sbjct: 54 GAGNHAAGILTLGKRRPGPPGLQGRLQRLLQASGNHAAGILTMGRRAGAEPAPRPCPGRR 113 Query: 229 C 227 C Sbjct: 114 C 114
>RL2_BORPE (Q7VTD0) 50S ribosomal protein L2| Length = 275 Score = 31.2 bits (69), Expect = 1.8 Identities = 25/80 (31%), Positives = 35/80 (43%) Frame = -2 Query: 481 ANRRDKVVRKVFELNLGLDTAAPVDRGVGAPGRANGFQRGVRRRPGQDLLRGDVQDLRQG 302 A RR V +L+ G AA +++ GR N VR R G V D R+ Sbjct: 11 AGRRGMVKVVSPKLHKGAPHAALLEKKTRGSGRNNNGHITVRHRGGGHKQHYRVVDFRRN 70 Query: 301 PGLRDGVPGLRRRAEVEPHR 242 +DG+P R E +P+R Sbjct: 71 ---KDGIPAKVERLEYDPNR 87
>RL2_BORPA (Q7W2F3) 50S ribosomal protein L2| Length = 275 Score = 31.2 bits (69), Expect = 1.8 Identities = 25/80 (31%), Positives = 35/80 (43%) Frame = -2 Query: 481 ANRRDKVVRKVFELNLGLDTAAPVDRGVGAPGRANGFQRGVRRRPGQDLLRGDVQDLRQG 302 A RR V +L+ G AA +++ GR N VR R G V D R+ Sbjct: 11 AGRRGMVKVVSPKLHKGAPHAALLEKKTRGSGRNNNGHITVRHRGGGHKQHYRVVDFRRN 70 Query: 301 PGLRDGVPGLRRRAEVEPHR 242 +DG+P R E +P+R Sbjct: 71 ---KDGIPAKVERLEYDPNR 87
>RL2_BORBR (Q7WRC2) 50S ribosomal protein L2| Length = 275 Score = 31.2 bits (69), Expect = 1.8 Identities = 25/80 (31%), Positives = 35/80 (43%) Frame = -2 Query: 481 ANRRDKVVRKVFELNLGLDTAAPVDRGVGAPGRANGFQRGVRRRPGQDLLRGDVQDLRQG 302 A RR V +L+ G AA +++ GR N VR R G V D R+ Sbjct: 11 AGRRGMVKVVSPKLHKGAPHAALLEKKTRGSGRNNNGHITVRHRGGGHKQHYRVVDFRRN 70 Query: 301 PGLRDGVPGLRRRAEVEPHR 242 +DG+P R E +P+R Sbjct: 71 ---KDGIPAKVERLEYDPNR 87
>5E5_RAT (Q63003) 5E5 antigen| Length = 825 Score = 30.8 bits (68), Expect = 2.3 Identities = 21/51 (41%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = -2 Query: 421 AAPVDRGVGAP-GRANGFQRGVRRRPGQDLLRGDVQDLRQGPGLRDGVPGL 272 +AP + G P GRA G ++ RRR G RG Q +GPG V GL Sbjct: 473 SAPEGQAGGGPRGRARGPRQQARRRHGPQRRRGPPQAGEEGPGDATLVLGL 523
>IE63_HHV2H (P28276) Transcriptional regulator IE63 (VMW63) (ICP27)| Length = 512 Score = 30.8 bits (68), Expect = 2.3 Identities = 23/66 (34%), Positives = 24/66 (36%) Frame = -2 Query: 376 GFQRGVRRRPGQDLLRGDVQDLRQGPGLRDGVPGLRRRAEVEPHRPGERCRGGRRHVLPA 197 G +RG RR G R GPG D P RRR H G R R P Sbjct: 139 GGRRGRRRGRG-----------RYGPGGADSTPKPRRRVSRNAHNQGGRHPASARTDGPG 187 Query: 196 EIHGRA 179 HG A Sbjct: 188 ATHGEA 193
>ERBB2_CANFA (O18735) Receptor tyrosine-protein kinase erbB-2 precursor (EC| 2.7.10.1) (p185erbB2) (C-erbB-2) Length = 1259 Score = 30.8 bits (68), Expect = 2.3 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 5/57 (8%) Frame = -2 Query: 475 RRDKVVR--KVFELNLGL---DTAAPVDRGVGAPGRANGFQRGVRRRPGQDLLRGDV 320 +R ++VR ++FE N L D P++ G+ APG A G R ++ R ++L+G V Sbjct: 97 QRLRIVRGTQLFEDNYALAVLDNGDPLEGGIPAPGAAQGGLRELQLRSLTEILKGGV 153
>RL2_PSEAE (Q9HWD8) 50S ribosomal protein L2| Length = 273 Score = 30.8 bits (68), Expect = 2.3 Identities = 31/126 (24%), Positives = 53/126 (42%), Gaps = 15/126 (11%) Frame = -2 Query: 490 CDPANRRDKVVRKVF--ELNLGLDTAAPVDRGVGAPGRANGFQRGVRRRPGQDLLRGDVQ 317 C P + + V KV EL+ G A +++ + GR N + R G + Sbjct: 6 CKPTSAGRRFVVKVVNQELHKGAPYAPLLEKKSKSGGRNNNGRITTRHIGGGHKQHYRLV 65 Query: 316 DLRQGPGLRDGVPGLRRRAEVEPHRPG-----ERCRGGRRHVLPAE--------IHGRAA 176 D R+ +DG+P + R E +P+R + G RR+++ + I G A Sbjct: 66 DFRRN---KDGIPAIVERVEYDPNRTAHIALLKYADGERRYIIAPKGVAAGDQLISGIGA 122 Query: 175 PLKVAD 158 P+K + Sbjct: 123 PIKAGN 128
>IE63_HHV1E (P36295) Transcriptional regulator IE63 (VMW63) (ICP27)| Length = 511 Score = 30.8 bits (68), Expect = 2.3 Identities = 25/68 (36%), Positives = 28/68 (41%) Frame = -2 Query: 382 ANGFQRGVRRRPGQDLLRGDVQDLRQGPGLRDGVPGLRRRAEVEPHRPGERCRGGRRHVL 203 A G +RG RR G R GPG DG+ RRRA PG+R G Sbjct: 137 ARGGRRGRRRGRG-----------RGGPGAADGLSDPRRRAPRTNRNPGDRPGAGWTDG- 184 Query: 202 PAEIHGRA 179 P HG A Sbjct: 185 PGAPHGEA 192
>HEM3_HALSA (Q9HMY5) Probable porphobilinogen deaminase (EC 2.5.1.61) (PBG)| (Hydroxymethylbilane synthase) (HMBS) (Pre-uroporphyrinogen synthase) Length = 396 Score = 30.0 bits (66), Expect = 4.0 Identities = 18/42 (42%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = -2 Query: 358 RRRPGQDLLRGDVQDLRQGP-GLRDGVPGLRRRAEVEPHRPG 236 R P L+ D DL P G G LRR A+V+ HRPG Sbjct: 99 RENPADVLVTPDGTDLEDLPAGSVVGTASLRRGAQVQAHRPG 140
>DEPP_PONPY (Q5RBE4) Protein DEPP| Length = 212 Score = 30.0 bits (66), Expect = 4.0 Identities = 25/86 (29%), Positives = 34/86 (39%), Gaps = 18/86 (20%) Frame = -2 Query: 361 VRRRPGQDLLRGDVQDLRQGPGLRDGVPGLRRRAEVE--------------PHRPGERCR 224 +R + LL G Q+ P L D V + R A+ PHRP + CR Sbjct: 15 IRETTEEMLLGGPGQEPPPSPSLDDYVRSISRLAQPTSVLDKATAQGQPRPPHRPAQACR 74 Query: 223 GGRRHV----LPAEIHGRAAPLKVAD 158 GR V + A G+ L +AD Sbjct: 75 KGRPAVSLRDITARFSGQQPTLPMAD 100
>DEPP_HUMAN (Q9NTK1) Protein DEPP (Decidual protein induced by progesterone)| (Fasting-induced gene protein) (FIG) Length = 212 Score = 30.0 bits (66), Expect = 4.0 Identities = 25/86 (29%), Positives = 34/86 (39%), Gaps = 18/86 (20%) Frame = -2 Query: 361 VRRRPGQDLLRGDVQDLRQGPGLRDGVPGLRRRAEVE--------------PHRPGERCR 224 +R + LL G Q+ P L D V + R A+ PHRP + CR Sbjct: 15 IRETTEEMLLGGPGQEPPPSPSLDDYVRSISRLAQPTSVLDKATAQGQPRPPHRPAQACR 74 Query: 223 GGRRHV----LPAEIHGRAAPLKVAD 158 GR V + A G+ L +AD Sbjct: 75 KGRPAVSLRDITARFSGQQPTLPMAD 100
>KCNC4_HUMAN (Q03721) Potassium voltage-gated channel subfamily C member 4| (Voltage-gated potassium channel subunit Kv3.4) (KSHIIIC) Length = 635 Score = 29.6 bits (65), Expect = 5.2 Identities = 21/69 (30%), Positives = 30/69 (43%) Frame = +2 Query: 269 PETRHAVAKSRTLPKILNISTE*ILSWPAANTALESIGASGCADASVHWSSGIEPEVQLE 448 PE R A+ +S T + + AA L S G CAD SV + + ++ L+ Sbjct: 568 PEERRALRRSTTRDR----------NKKAAACFLLSTGDYACADGSVRKGTFVLRDLPLQ 617 Query: 449 HLPHHLVPP 475 H P PP Sbjct: 618 HSPEAACPP 626
>EWS_MOUSE (Q61545) RNA-binding protein EWS| Length = 655 Score = 29.6 bits (65), Expect = 5.2 Identities = 26/72 (36%), Positives = 30/72 (41%), Gaps = 6/72 (8%) Frame = -2 Query: 409 DRGVGAPGRANGFQRGVRRRPGQDLL-----RGDVQDLRQGPGL-RDGVPGLRRRAEVEP 248 DRG G PG G + G+ R G + GD R G G+ R G G RR P Sbjct: 561 DRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGGPGGP 620 Query: 247 HRPGERCRGGRR 212 P GGRR Sbjct: 621 PGPLMEQMGGRR 632
>MINC_SALTY (P65359) Septum site-determining protein minC| Length = 235 Score = 29.6 bits (65), Expect = 5.2 Identities = 22/69 (31%), Positives = 32/69 (46%), Gaps = 14/69 (20%) Frame = +2 Query: 245 MRLHLCSPPETRHAV--------AKSRTLPKILNIS-TE*ILSWP-----AANTALESIG 382 + LH P R A+ A + P ++N+S E ++WP +T L IG Sbjct: 18 VHLHEAEPEVIRQALEDKIAQAPAFLKHAPVVINVSGLESPVNWPELHKIVTSTGLRIIG 77 Query: 383 ASGCADASV 409 SGC DAS+ Sbjct: 78 VSGCKDASL 86
>MINC_SALTI (P65360) Septum site-determining protein minC| Length = 235 Score = 29.6 bits (65), Expect = 5.2 Identities = 22/69 (31%), Positives = 32/69 (46%), Gaps = 14/69 (20%) Frame = +2 Query: 245 MRLHLCSPPETRHAV--------AKSRTLPKILNIS-TE*ILSWP-----AANTALESIG 382 + LH P R A+ A + P ++N+S E ++WP +T L IG Sbjct: 18 VHLHEAEPEVIRQALEDKIAQAPAFLKHAPVVINVSGLESPVNWPELHKIVTSTGLRIIG 77 Query: 383 ASGCADASV 409 SGC DAS+ Sbjct: 78 VSGCKDASL 86
>EWS_HUMAN (Q01844) RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma| breakpoint region 1 protein) Length = 656 Score = 29.6 bits (65), Expect = 5.2 Identities = 26/72 (36%), Positives = 30/72 (41%), Gaps = 6/72 (8%) Frame = -2 Query: 409 DRGVGAPGRANGFQRGVRRRPGQDLL-----RGDVQDLRQGPGL-RDGVPGLRRRAEVEP 248 DRG G PG G + G+ R G + GD R G G+ R G G RR P Sbjct: 562 DRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGGPGGP 621 Query: 247 HRPGERCRGGRR 212 P GGRR Sbjct: 622 PGPLMEQMGGRR 633
>RL2_PSEPK (Q88QN2) 50S ribosomal protein L2| Length = 274 Score = 29.3 bits (64), Expect = 6.8 Identities = 31/126 (24%), Positives = 51/126 (40%), Gaps = 15/126 (11%) Frame = -2 Query: 490 CDPANRRDKVVRKVF--ELNLGLDTAAPVDRGVGAPGRANGFQRGVRRRPGQDLLRGDVQ 317 C P + + V KV EL+ G A +++ + GR N + R G + Sbjct: 6 CKPTSPGRRFVVKVVNKELHKGAPHAPLIEKKSKSGGRNNNGRITTRHVGGGHKQHYRLV 65 Query: 316 DLRQGPGLRDGVPGLRRRAEVEPHRPGE-----RCRGGRRHVLPAE--------IHGRAA 176 D R+ +DG+P R E +P+R G RR+++ + I G A Sbjct: 66 DFRRND--KDGIPATVERIEYDPNRTAHIALLCYADGERRYIIAPKGVSAGDQLIAGALA 123 Query: 175 PLKVAD 158 P+K + Sbjct: 124 PIKAGN 129
>OREX_MOUSE (O55241) Orexin precursor (Hypocretin) (Hcrt) [Contains: Orexin-A| (Hypocretin-1) (Hcrt1); Orexin-B (Hypocretin-2) (Hcrt2)] Length = 130 Score = 29.3 bits (64), Expect = 6.8 Identities = 21/54 (38%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Frame = -2 Query: 397 GAPGRANGFQRGVRRRPGQDLLRGDVQDLRQGPGLRDG---VPGLRRRAEVEPH 245 GA A G +RRPG L+G +Q L Q G G R AE+EPH Sbjct: 54 GAGNHAAGILTLGKRRPGPPGLQGRLQRLLQANGNHAAGILTMGRRAGAELEPH 107
>IE63_HHV11 (P10238) Transcriptional regulator IE63 (VMW63) (ICP27)| Length = 512 Score = 28.9 bits (63), Expect = 8.9 Identities = 24/68 (35%), Positives = 26/68 (38%) Frame = -2 Query: 382 ANGFQRGVRRRPGQDLLRGDVQDLRQGPGLRDGVPGLRRRAEVEPHRPGERCRGGRRHVL 203 A G +RG RR G R GPG DG+ RRRA PG G Sbjct: 137 ARGGRRGRRRGRG-----------RGGPGAADGLSDPRRRAPRTNRNPGGPRPGAGWTDG 185 Query: 202 PAEIHGRA 179 P HG A Sbjct: 186 PGAPHGEA 193
>MIAA_RALSO (Q8XWB0) tRNA delta(2)-isopentenylpyrophosphate transferase (EC| 2.5.1.8) (IPP transferase) (Isopentenyl-diphosphate:tRNA isopentenyltransferase) (IPTase) (IPPT) Length = 323 Score = 28.9 bits (63), Expect = 8.9 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -2 Query: 298 GLRDGVPGLRRRAEVEPHRPGERCRGGRR 212 GL D V LRRR ++ P P RC G R+ Sbjct: 231 GLLDEVEALRRRGDLSPVLPSIRCVGYRQ 259
>SPEN_DROME (Q8SX83) Protein split ends| Length = 5560 Score = 28.9 bits (63), Expect = 8.9 Identities = 13/49 (26%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = +1 Query: 43 HSKQCNAMELLYRAAH--QSATHGSNKQIISVSGKEKQSRHRRPSEEQH 183 H +Q +++ R H Q HG ++QI S + +H+ ++QH Sbjct: 3832 HMQQFMHQQMIQRQQHMQQQQLHGQSQQITSAPQHQMHQQHQAQQQQQH 3880 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,380,860 Number of Sequences: 219361 Number of extensions: 1347741 Number of successful extensions: 4942 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 4681 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4938 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3927707336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
