| Clone Name | rbags19p06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NUCM_TRYBB (P21301) NADH-ubiquinone oxidoreductase 49 kDa subuni... | 28 | 8.9 |
|---|
>NUCM_TRYBB (P21301) NADH-ubiquinone oxidoreductase 49 kDa subunit homolog (EC| 1.6.5.3) (NADH dehydrogenase subunit 7 homolog) Length = 386 Score = 27.7 bits (60), Expect = 8.9 Identities = 18/53 (33%), Positives = 21/53 (39%) Frame = -2 Query: 171 LHLCGIVLFXHLELVFVGTRGYHGYKLCCLFVCLGMCWICTAFVCRHVXSMLC 13 L L G+ F +LVF G L LGM W C F C + M C Sbjct: 201 LRLRGLSFFDLYDLVFNSLSGV-------LSRSLGMVWDCRLFSCYELYFMFC 246 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,037,139 Number of Sequences: 219361 Number of extensions: 403046 Number of successful extensions: 943 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 932 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 942 length of database: 80,573,946 effective HSP length: 32 effective length of database: 73,554,394 effective search space used: 1765305456 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)