| Clone Name | rbags19n18 |
|---|---|
| Clone Library Name | barley_pub |
>SHAN1_HUMAN (Q9Y566) SH3 and multiple ankyrin repeat domains protein 1 (Shank1)| (Somatostatin receptor-interacting protein) (SSTR-interacting protein) (SSTRIP) Length = 2161 Score = 28.9 bits (63), Expect = 6.6 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +3 Query: 111 PPPTPRKACTPSKTDPIHI*ENQVR*LC*IRPPSP 215 PPP+PR++ PS T P EN + L + PP+P Sbjct: 1519 PPPSPRRSVPPSPTSPRASEENGLP-LLVLPPPAP 1552
>ESR1_ONCMY (P16058) Estrogen receptor (ER) (Estradiol receptor) (ER-alpha)| Length = 622 Score = 28.5 bits (62), Expect = 8.6 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +2 Query: 110 TATHTS*GLHPFKNGSDTHIREPGTVAL 193 T T T + P + DTHIR PG+ L Sbjct: 582 TTTSTGSSIGPMRGSQDTHIRSPGSGVL 609
>LPPX_MYCTU (P65306) Putative lipoprotein lppX precursor| Length = 233 Score = 28.5 bits (62), Expect = 8.6 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -1 Query: 186 TVPGSLICVSDPFLKGCRPYEVWVAV*GT 100 T+P S + + DP K RP VW+A G+ Sbjct: 176 TIPASSVKMLDPGAKSARPATVWIAQDGS 204
>LPPX_MYCBO (P65307) Putative lipoprotein lppX precursor| Length = 233 Score = 28.5 bits (62), Expect = 8.6 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -1 Query: 186 TVPGSLICVSDPFLKGCRPYEVWVAV*GT 100 T+P S + + DP K RP VW+A G+ Sbjct: 176 TIPASSVKMLDPGAKSARPATVWIAQDGS 204
>ESR1_SALSA (P50242) Estrogen receptor (ER) (Estradiol receptor) (ER-alpha)| (Fragment) Length = 535 Score = 28.5 bits (62), Expect = 8.6 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +2 Query: 110 TATHTS*GLHPFKNGSDTHIREPGTVAL 193 T T T + P + DTHIR PG+ L Sbjct: 495 TTTSTGSSIGPMRGSQDTHIRSPGSGVL 522
>TRMD_BACSU (O31741) tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.31)| (M1G-methyltransferase) (tRNA [GM37] methyltransferase) Length = 243 Score = 28.5 bits (62), Expect = 8.6 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 52 PTTIKSEVAHNNDTQSSPLNRHPHLVRPA 138 P + E +H D+ S+ L HPH RPA Sbjct: 157 PGVLGKEASHIEDSFSTGLLEHPHYTRPA 185
>ATM_ASHGO (Q751J3) Serine/threonine-protein kinase TEL1 (EC 2.7.11.1)| (DNA-damage checkpoint kinase TEL1) (Telomere length regulation protein 1) (ATM homolog) Length = 2768 Score = 28.5 bits (62), Expect = 8.6 Identities = 17/45 (37%), Positives = 24/45 (53%) Frame = +2 Query: 245 LREML*VVLDLGAFFLACLLGTEFFMPRKKRRAPNSARFCVNFMK 379 L++ V ++G ++ACLL EF M PN AR V +MK Sbjct: 1709 LQDAYKVAAEVGEKYIACLLFEEFHM-------PNLARLDVTYMK 1746 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,344,432 Number of Sequences: 219361 Number of extensions: 1290102 Number of successful extensions: 4127 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3755 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4117 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)