| Clone Name | rbags19n08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UDG5_ECOLI (Q47329) UDP-glucose 6-dehydrogenase (EC 1.1.1.22) (U... | 33 | 0.67 | 2 | TBX12_CAEEL (P90971) T-box protein 12 (Protein male abnormal 9) | 30 | 5.7 | 3 | CAT5_YEAST (P41735) Catabolite repression protein CAT5 (Ubiquino... | 30 | 9.7 |
|---|
>UDG5_ECOLI (Q47329) UDP-glucose 6-dehydrogenase (EC 1.1.1.22) (UDP-Glc| dehydrogenase) (UDP-GlcDH) (UDPGDH) Length = 392 Score = 33.5 bits (75), Expect = 0.67 Identities = 18/61 (29%), Positives = 32/61 (52%) Frame = +2 Query: 20 LALMQGHPCYRFLVTERN*KLE*SNDRSSGVSVKDRKNYQSTTIITINTSYHKYQALHNQ 199 + + Q H F ++ K++ ND+ S + K+ +NY ST I+ + +KY+A N Sbjct: 21 ILMAQNHEVVAFDTHQK--KVDLLNDKLSPIEDKEIENYLSTKILNFRATTNKYEAYKNA 78 Query: 200 N 202 N Sbjct: 79 N 79
>TBX12_CAEEL (P90971) T-box protein 12 (Protein male abnormal 9)| Length = 346 Score = 30.4 bits (67), Expect = 5.7 Identities = 14/48 (29%), Positives = 29/48 (60%) Frame = +2 Query: 239 VLSKFSRNLWPTMTVSTANVLLESAFGDASVLIKVVPPESEKEEAFLN 382 +++K R ++PT+ VS NV+L++ + + + VVP +S++ N Sbjct: 98 IITKSGRRMFPTVKVSFTNVILDALY---YIFLDVVPVDSKRYRYIYN 142
>CAT5_YEAST (P41735) Catabolite repression protein CAT5 (Ubiquinone| biosynthesis protein COQ7) (Coenzyme Q biosynthesis protein 7) Length = 233 Score = 29.6 bits (65), Expect = 9.7 Identities = 19/40 (47%), Positives = 23/40 (57%) Frame = -2 Query: 387 TLLRKASSFSLSGGTTFISTDASPNADSSSTLAVETVIVG 268 T L KA +F++ GT IS P A + T AVETVI G Sbjct: 117 TPLWKAGAFAMGAGTALIS----PEAAMACTEAVETVIGG 152 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 94,565,373 Number of Sequences: 219361 Number of extensions: 1818951 Number of successful extensions: 3408 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3345 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3408 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7366267610 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)