| Clone Name | rbaak4o05 |
|---|---|
| Clone Library Name | barley_pub |
>G3PB_ARATH (P25857) Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast| precursor (EC 1.2.1.13) (NADP-dependent glyceraldehydephosphate dehydrogenase subunit B) Length = 447 Score = 37.0 bits (84), Expect = 0.013 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = -3 Query: 271 DPLEDYCKTDPNAVECKVFD 212 DPLED+CKT+P ECKV+D Sbjct: 428 DPLEDFCKTNPADEECKVYD 447
>G3PB_PEA (P12859) Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast| precursor (EC 1.2.1.13) (NADP-dependent glyceraldehydephosphate dehydrogenase subunit B) Length = 451 Score = 33.9 bits (76), Expect = 0.11 Identities = 12/20 (60%), Positives = 17/20 (85%) Frame = -3 Query: 271 DPLEDYCKTDPNAVECKVFD 212 DPLED+C+T+P ECKV++ Sbjct: 432 DPLEDFCETNPADEECKVYE 451
>G3PB_SPIOL (P12860) Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast| precursor (EC 1.2.1.13) (NADP-dependent glyceraldehydephosphate dehydrogenase subunit B) Length = 451 Score = 32.0 bits (71), Expect = 0.42 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = -3 Query: 271 DPLEDYCKTDPNAVECKVFD 212 DPLED+CK +P ECK+++ Sbjct: 432 DPLEDFCKDNPADEECKLYE 451
>HYFJ_ECOLI (P77453) Hydrogenase-4 component J (EC 1.-.-.-)| Length = 137 Score = 28.9 bits (63), Expect = 3.6 Identities = 15/65 (23%), Positives = 33/65 (50%), Gaps = 5/65 (7%) Frame = -3 Query: 184 WLDRSRLIRKRNE----ATTVHYYRLSIAYNMDLLDCVSFVSRL-LAELAAWCSIYQTGF 20 W R + + +E ++ V YY L+I +++ ++DC++ R L E W ++ + Sbjct: 11 WTLRKKFVASSDEMPEHSSQVMYYSLAIGHHVGVIDCLNVAFRCPLTEYEDWLALVEEEQ 70 Query: 19 GQNKL 5 + K+ Sbjct: 71 ARRKM 75
>LIPA_BACTN (Q8A029) Lipoyl synthase (EC 2.8.1.-) (Lipoic acid synthase)| (Lipoate synthase) (Lipoyl-acyl-carrier protein synthase) (Sulfur insertion protein lipA) (Lip-syn) Length = 282 Score = 28.5 bits (62), Expect = 4.7 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -3 Query: 214 DE*TELGAGCWLDRSRLIRKRNEATTVHYYRLSIAYNMDLLDCV 83 D+ +LGAG W R I++ N TT+ M+L+D V Sbjct: 108 DDLPDLGAGHWAHTIREIKRLNPQTTIEVLIPDFQGRMELVDLV 151
>MYSN_ACACA (P05659) Myosin-2 heavy chain, non muscle (Myosin II heavy chain,| non muscle) Length = 1509 Score = 27.7 bits (60), Expect = 8.0 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -1 Query: 225 ARCSTSERSSELVAGLTGRG*SENATKQLQYIIIV 121 A +T + S L+ G +G G +EN K +QY+ + Sbjct: 168 AMLNTRQNQSMLITGESGAGKTENTKKVIQYLTAI 202 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,294,606 Number of Sequences: 219361 Number of extensions: 477800 Number of successful extensions: 1090 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1081 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1089 length of database: 80,573,946 effective HSP length: 66 effective length of database: 66,096,120 effective search space used: 1586306880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)