| Clone Name | rbags19m03 |
|---|---|
| Clone Library Name | barley_pub |
>AP2M_DICDI (P54672) AP-2 complex subunit mu (Clathrin coat assembly protein| AP50) (Clathrin coat-associated protein AP50) (Plasma membrane adaptor AP-2 50 kDa protein) (Clathrin assembly protein complex 2 medium chain) Length = 439 Score = 84.0 bits (206), Expect(2) = 4e-17 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 1/66 (1%) Frame = -2 Query: 606 AEVELISTMG-EKKLANRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYNTVEWVRYITRA 430 AEVEL++++ +KK +RPPI MEFQV MFTASG VRFLKV EKS Y ++WVRY+T+A Sbjct: 373 AEVELMASVNLDKKAWSRPPISMEFQVTMFTASGFSVRFLKVVEKSNYTPIKWVRYLTKA 432 Query: 429 GSYEIR 412 G+Y+ R Sbjct: 433 GTYQNR 438 Score = 23.5 bits (49), Expect(2) = 4e-17 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = -1 Query: 649 KIRKFPGQTEATMK 608 +IR+FPG TE T++ Sbjct: 359 RIRRFPGDTEFTLR 372
>AP1M_CAEEL (P35602) AP-1 complex subunit mu (Clathrin coat assembly protein| AP47) (Clathrin coat-associated protein AP47) (Golgi adaptor AP-1 47 kDa protein) (HA1 47 kDa subunit) (Clathrin assembly protein assembly protein complex 1 medium chain) (Uncoor Length = 422 Score = 75.1 bits (183), Expect = 2e-13 Identities = 34/66 (51%), Positives = 49/66 (74%) Frame = -2 Query: 609 SAEVELISTMGEKKLANRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYNTVEWVRYITRA 430 +A + L S M E+ RPPI+++F++P FT SG++VR+LK+ EKSGY + WVRYIT+ Sbjct: 356 TAHLSLPSVMSEES-EGRPPIKVKFEIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQN 414 Query: 429 GSYEIR 412 G YE+R Sbjct: 415 GEYEMR 420
>AP2M_CAEEL (P35603) AP-2 complex subunit mu (Clathrin coat assembly protein| AP50) (Clathrin coat-associated protein AP50) (Plasma membrane adaptor AP-2 50 kDa protein) (Clathrin assembly protein complex 2 medium chain) (Dumpy protein 23) Length = 441 Score = 73.2 bits (178), Expect = 6e-13 Identities = 39/72 (54%), Positives = 52/72 (72%), Gaps = 5/72 (6%) Frame = -2 Query: 609 SAEVELISTMG-EKKLANRPPIQMEFQVPMFTASGLRVRFLKVWEK----SGYNTVEWVR 445 SAE++L+ST EKK NRPP+ M F+VP F SGL+VR+LKV+E S ++ ++WVR Sbjct: 371 SAEIDLLSTGNVEKKKWNRPPVSMNFEVP-FAPSGLKVRYLKVFEPKLNYSDHDVIKWVR 429 Query: 444 YITRAGSYEIRC 409 YI R+G YE RC Sbjct: 430 YIGRSGLYETRC 441
>AP2M1_RAT (P84092) AP-2 complex subunit mu-1 (Adaptin mu-1) (AP-2 mu-2 chain)| (Clathrin coat assembly protein AP50) (Clathrin coat-associated protein AP50) (Plasma membrane adaptor AP-2 50 kDa protein) (Clathrin assembly protein complex 2 medium chain) Length = 435 Score = 71.6 bits (174), Expect = 2e-12 Identities = 39/71 (54%), Positives = 51/71 (71%), Gaps = 4/71 (5%) Frame = -2 Query: 609 SAEVELISTMGEKKLANRPPIQMEFQVPMFTASGLRVRFLKVWEK----SGYNTVEWVRY 442 SAE+EL+ T +KK A RPPI M F+VP F SGL+VR+LKV+E S ++ ++WVRY Sbjct: 367 SAEIELLPTNDKKKWA-RPPISMNFEVP-FAPSGLKVRYLKVFEPKLNYSDHDVIKWVRY 424 Query: 441 ITRAGSYEIRC 409 I R+G YE RC Sbjct: 425 IGRSGIYETRC 435
>AP2M1_MOUSE (P84091) AP-2 complex subunit mu-1 (Adaptin mu-1) (AP-2 mu-2 chain)| (Clathrin coat assembly protein AP50) (Clathrin coat-associated protein AP50) (Plasma membrane adaptor AP-2 50 kDa protein) (Clathrin assembly protein complex 2 medium chain) Length = 435 Score = 71.6 bits (174), Expect = 2e-12 Identities = 39/71 (54%), Positives = 51/71 (71%), Gaps = 4/71 (5%) Frame = -2 Query: 609 SAEVELISTMGEKKLANRPPIQMEFQVPMFTASGLRVRFLKVWEK----SGYNTVEWVRY 442 SAE+EL+ T +KK A RPPI M F+VP F SGL+VR+LKV+E S ++ ++WVRY Sbjct: 367 SAEIELLPTNDKKKWA-RPPISMNFEVP-FAPSGLKVRYLKVFEPKLNYSDHDVIKWVRY 424 Query: 441 ITRAGSYEIRC 409 I R+G YE RC Sbjct: 425 IGRSGIYETRC 435
>AP2M1_HUMAN (Q96CW1) AP-2 complex subunit mu-1 (Adaptin mu-1) (AP-2 mu-2 chain)| (Clathrin coat assembly protein AP50) (Clathrin coat-associated protein AP50) (Plasma membrane adaptor AP-2 50 kDa protein) (HA2 50 kDa subunit) (Clathrin assembly protein co Length = 435 Score = 71.6 bits (174), Expect = 2e-12 Identities = 39/71 (54%), Positives = 51/71 (71%), Gaps = 4/71 (5%) Frame = -2 Query: 609 SAEVELISTMGEKKLANRPPIQMEFQVPMFTASGLRVRFLKVWEK----SGYNTVEWVRY 442 SAE+EL+ T +KK A RPPI M F+VP F SGL+VR+LKV+E S ++ ++WVRY Sbjct: 367 SAEIELLPTNDKKKWA-RPPISMNFEVP-FAPSGLKVRYLKVFEPKLNYSDHDVIKWVRY 424 Query: 441 ITRAGSYEIRC 409 I R+G YE RC Sbjct: 425 IGRSGIYETRC 435
>AP1M2_HUMAN (Q9Y6Q5) AP-1 complex subunit mu-2 (Adaptor-related protein complex| 1 mu-2 subunit) (Mu-adaptin 2) (Adaptor protein complex AP-1 mu-2 subunit) (Golgi adaptor HA1/AP1 adaptin mu-2 subunit) (Clathrin assembly protein assembly protein complex 1 Length = 423 Score = 71.6 bits (174), Expect = 2e-12 Identities = 27/60 (45%), Positives = 48/60 (80%) Frame = -2 Query: 591 ISTMGEKKLANRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYNTVEWVRYITRAGSYEIR 412 + ++ ++++ RPPI ++F++P FT SG++VR++K+ EKSGY + WVRYIT++G Y++R Sbjct: 362 LPSVEKEEVEGRPPIGVKFEIPYFTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR 421
>AP1M2_MOUSE (Q9WVP1) AP-1 complex subunit mu-2 (Adaptor-related protein complex| 1 mu-2 subunit) (Mu-adaptin 2) (Adaptor protein complex AP-1 mu-2 subunit) (Golgi adaptor HA1/AP1 adaptin mu-2 subunit) (Clathrin assembly protein assembly protein complex 1 Length = 423 Score = 70.9 bits (172), Expect = 3e-12 Identities = 27/54 (50%), Positives = 44/54 (81%) Frame = -2 Query: 573 KKLANRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYNTVEWVRYITRAGSYEIR 412 +++ RPPI ++F++P FT SG++VR++K+ EKSGY + WVRYIT++G Y++R Sbjct: 368 EEVEGRPPIGVKFEIPYFTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR 421
>AP1M1_MOUSE (P35585) AP-1 complex subunit mu-1 (Adaptor-related protein complex| 1 mu-1 subunit) (Mu-adaptin 1) (Adaptor protein complex AP-1 mu-1 subunit) (Golgi adaptor HA1/AP1 adaptin mu-1 subunit) (Clathrin assembly protein assembly protein complex 1 Length = 422 Score = 69.3 bits (168), Expect = 9e-12 Identities = 27/49 (55%), Positives = 40/49 (81%) Frame = -2 Query: 558 RPPIQMEFQVPMFTASGLRVRFLKVWEKSGYNTVEWVRYITRAGSYEIR 412 +PPI ++F++P FT SG++VR+LK+ EKSGY + WVRYIT+ G Y++R Sbjct: 372 KPPISVKFEIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLR 420
>AP1M1_HUMAN (Q9BXS5) AP-1 complex subunit mu-1 (Adaptor-related protein complex| 1 mu-1 subunit) (Mu-adaptin 1) (Adaptor protein complex AP-1 mu-1 subunit) (Golgi adaptor HA1/AP1 adaptin mu-1 subunit) (Clathrin assembly protein assembly protein complex 1 Length = 422 Score = 69.3 bits (168), Expect = 9e-12 Identities = 27/49 (55%), Positives = 40/49 (81%) Frame = -2 Query: 558 RPPIQMEFQVPMFTASGLRVRFLKVWEKSGYNTVEWVRYITRAGSYEIR 412 +PPI ++F++P FT SG++VR+LK+ EKSGY + WVRYIT+ G Y++R Sbjct: 372 KPPISVKFEIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLR 420
>AP2M_SCHPO (Q09718) AP-2 complex subunit mu (Probable clathrin coat assembly| protein AP50) (Clathrin coat-associated protein AP50) (Plasma membrane adaptor AP-2 50 kDa protein) (Clathrin assembly protein complex 2 medium chain) Length = 446 Score = 64.7 bits (156), Expect = 2e-10 Identities = 34/67 (50%), Positives = 49/67 (73%), Gaps = 2/67 (2%) Frame = -2 Query: 606 AEVELISTMGEKKLANRPPIQMEFQVPMFTASGLRVRFLKVWEKSG--YNTVEWVRYITR 433 AEVEL +T ++ A +PPI ++F + MFT+SGL V++L+V E S Y +++WVRY TR Sbjct: 380 AEVELSNTTNQQIWA-KPPISLDFNILMFTSSGLHVQYLRVSEPSNSKYKSIKWVRYSTR 438 Query: 432 AGSYEIR 412 AG+ EIR Sbjct: 439 AGTCEIR 445
>AP2M_YEAST (Q99186) AP-2 complex subunit mu (Clathrin coat assembly protein| AP50) (Clathrin coat-associated protein AP50) (Plasma membrane adaptor AP-2 50 kDa protein) (Clathrin assembly protein complex 2 medium chain) (Adaptin medium chain APM4) Length = 491 Score = 57.0 bits (136), Expect = 5e-08 Identities = 26/50 (52%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = -2 Query: 558 RPPIQMEFQVPMFTASGLRVRFLKVWEK-SGYNTVEWVRYITRAGSYEIR 412 RPPI +EF+V MF+ SGL VR+ + K S + V+W++YI++AGSYE+R Sbjct: 441 RPPISLEFEVMMFSNSGLVVRYFTISGKDSKHRAVKWIKYISKAGSYEVR 490
>AP1M1_SCHPO (Q9HFE5) AP-1 complex subunit mu-1 (Mu(1)-adaptin) (Clathrin| assembly protein complex 1 medium chain) Length = 426 Score = 55.5 bits (132), Expect = 1e-07 Identities = 29/68 (42%), Positives = 46/68 (67%), Gaps = 3/68 (4%) Frame = -2 Query: 606 AEVELISTMGEK-KLANRPPIQMEFQVPMFTASGLRVRFLKVWE-KSGYNTVEWVRYITR 433 AE+ L S E ++ + P+Q++F +P FT SG++VR+LK+ E K Y+ + WVRY+T+ Sbjct: 358 AEMGLPSVKNEDIQVQKKRPVQLKFAIPYFTTSGIQVRYLKITEPKLNYHAMPWVRYVTQ 417 Query: 432 AGS-YEIR 412 G+ Y IR Sbjct: 418 NGTEYSIR 425
>AP1M1_YEAST (Q00776) AP-1 complex subunit mu-1 (Mu(1)-adaptin) (Clathrin| assembly protein complex 1 medium chain) (Clathrin coat assembly protein AP54) (Clathrin coat-associated protein AP54) (Golgi adaptor AP-1 54 kDa protein) (HA1 54 kDa subunit) Length = 475 Score = 53.9 bits (128), Expect = 4e-07 Identities = 26/49 (53%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = -2 Query: 552 PIQMEFQVPMFTASGLRVRFLKVWE-KSGYNTVEWVRYITRAG-SYEIR 412 P+Q++FQ+P FT SG++VR+LK+ E K Y + WVRYIT++G Y IR Sbjct: 425 PVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 473
>AP1M_DISOM (P47795) AP-1 complex subunit mu (Clathrin coat assembly protein| AP47 homolog) (Clathrin coat-associated protein AP47 homolog) (Golgi adaptor AP-1 47 kDa protein homolog) (HA1 47 kDa subunit homolog) (Clathrin assembly protein assembly protein Length = 418 Score = 39.3 bits (90), Expect = 0.010 Identities = 17/56 (30%), Positives = 33/56 (58%) Frame = -2 Query: 579 GEKKLANRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYNTVEWVRYITRAGSYEIR 412 GE K P + ++F++ SGL+V L ++ + Y + V+Y+T+AG +++R Sbjct: 363 GEAKPEENPTLNIQFRIQQLAVSGLKVNRLDMYGER-YKPFKGVKYVTKAGKFQVR 417
>AP4M1_MOUSE (Q9JKC7) AP-4 complex subunit mu-1 (Adapter-related protein complex| 4 mu-1 subunit) (Mu subunit of AP-4) (AP-4 adapter complex mu subunit) (Mu-adaptin-related protein 2) (mu-ARP2) (mu4) Length = 449 Score = 38.5 bits (88), Expect = 0.017 Identities = 18/49 (36%), Positives = 31/49 (63%), Gaps = 2/49 (4%) Frame = -2 Query: 552 PIQMEFQVPMFTASGLRVRFLKVWEKS--GYNTVEWVRYITRAGSYEIR 412 P + F++P T SGL+VRFL++ + N +WVR+++ + +Y IR Sbjct: 400 PASLSFELPRHTCSGLQVRFLRLSFSACGNANPHKWVRHLSHSNAYVIR 448
>AP4M1_RAT (Q2PWT8) AP-4 complex subunit mu-1 (Adapter-related protein complex| 4 mu-1 subunit) (Mu subunit of AP-4) (AP-4 adapter complex mu subunit) (Mu-adaptin-related protein 2) (mu-ARP2) (mu4) Length = 453 Score = 38.5 bits (88), Expect = 0.017 Identities = 18/49 (36%), Positives = 31/49 (63%), Gaps = 2/49 (4%) Frame = -2 Query: 552 PIQMEFQVPMFTASGLRVRFLKVWEKS--GYNTVEWVRYITRAGSYEIR 412 P + F++P T SGL+VRFL++ + N +WVR+++ + +Y IR Sbjct: 404 PASLSFELPRHTCSGLQVRFLRLSFSACGNANPHKWVRHLSHSNAYVIR 452
>AP4M1_HUMAN (O00189) AP-4 complex subunit mu-1 (Adapter-related protein complex| 4 mu-1 subunit) (Mu subunit of AP-4) (AP-4 adapter complex mu subunit) (Mu-adaptin-related protein 2) (mu-ARP2) (mu4) Length = 453 Score = 38.5 bits (88), Expect = 0.017 Identities = 18/49 (36%), Positives = 31/49 (63%), Gaps = 2/49 (4%) Frame = -2 Query: 552 PIQMEFQVPMFTASGLRVRFLKVWEK--SGYNTVEWVRYITRAGSYEIR 412 P + F++P T SGL+VRFL++ + N +WVR+++ + +Y IR Sbjct: 404 PASLSFELPRHTCSGLQVRFLRLAFRPCGNANPHKWVRHLSHSDAYVIR 452
>AP3M2_RAT (P53678) AP-3 complex subunit mu-2 (Adapter-related protein complex| 3 mu-2 subunit) (Clathrin coat assembly protein AP47 homolog 2) (Clathrin coat-associated protein AP47 homolog 2) (Golgi adaptor AP-1 47 kDa protein homolog 2) (HA1 47 kDa subu Length = 418 Score = 37.4 bits (85), Expect = 0.039 Identities = 16/57 (28%), Positives = 33/57 (57%) Frame = -2 Query: 582 MGEKKLANRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYNTVEWVRYITRAGSYEIR 412 +G K P I ++F++ SGL+V L ++ + Y + ++Y+T+AG +++R Sbjct: 362 VGASKPDENPTINLQFKIQQLAISGLKVNRLDMYGEK-YKPFKGIKYMTKAGKFQVR 417
>AP3M2_MOUSE (Q8R2R9) AP-3 complex subunit mu-2 (Adapter-related protein complex| 3 mu-2 subunit) (Clathrin coat assembly protein AP47 homolog 2) (Clathrin coat-associated protein AP47 homolog 2) (Golgi adaptor AP-1 47 kDa protein homolog 2) (HA1 47 kDa su Length = 418 Score = 37.4 bits (85), Expect = 0.039 Identities = 16/57 (28%), Positives = 33/57 (57%) Frame = -2 Query: 582 MGEKKLANRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYNTVEWVRYITRAGSYEIR 412 +G K P I ++F++ SGL+V L ++ + Y + ++Y+T+AG +++R Sbjct: 362 VGASKPDENPTINLQFKIQQLAISGLKVNRLDMYGEK-YKPFKGIKYMTKAGKFQVR 417
>APM2_YEAST (P38700) Adaptin medium chain homolog APM2| Length = 605 Score = 37.0 bits (84), Expect = 0.051 Identities = 17/39 (43%), Positives = 26/39 (66%), Gaps = 1/39 (2%) Frame = -2 Query: 549 IQMEFQVPMFTASGLRVRFLKVWE-KSGYNTVEWVRYIT 436 + ++F++P T SGL+V +LKV E + Y + WVRY T Sbjct: 557 VNIDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVRYKT 595
>AP3M2_HUMAN (P53677) AP-3 complex subunit mu-2 (Adapter-related protein complex| 3 mu-2 subunit) (Clathrin coat assembly protein AP47 homolog 2) (Clathrin coat-associated protein AP47 homolog 2) (Golgi adaptor AP-1 47 kDa protein homolog 2) (HA1 47 kDa su Length = 418 Score = 37.0 bits (84), Expect = 0.051 Identities = 16/56 (28%), Positives = 32/56 (57%) Frame = -2 Query: 579 GEKKLANRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYNTVEWVRYITRAGSYEIR 412 G K P I ++F++ SGL+V L ++ + Y + ++Y+T+AG +++R Sbjct: 363 GASKPDENPTINLQFKIQQLAISGLKVNRLDMYGEK-YKPFKGIKYMTKAGKFQVR 417
>AP3M1_RAT (P53676) AP-3 complex subunit mu-1 (Adapter-related protein complex| 3 mu-1 subunit) (Mu-adaptin 3A) (AP-3 adapter complex mu3A subunit) (Clathrin coat assembly protein AP47 homolog 1) (Clathrin coat-associated protein AP47 homolog 1) (Golgi ada Length = 418 Score = 37.0 bits (84), Expect = 0.051 Identities = 17/56 (30%), Positives = 32/56 (57%) Frame = -2 Query: 579 GEKKLANRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYNTVEWVRYITRAGSYEIR 412 G K P + ++F++ SGL+V L ++ + Y + V+YIT+AG +++R Sbjct: 363 GAPKPEENPNLNIQFKIQQLAISGLKVNRLDMYGEK-YKPFKGVKYITKAGKFQVR 417
>AP3M1_HUMAN (Q9Y2T2) AP-3 complex subunit mu-1 (Adapter-related protein complex| 3 mu-1 subunit) (Mu-adaptin 3A) (AP-3 adapter complex mu3A subunit) Length = 418 Score = 37.0 bits (84), Expect = 0.051 Identities = 16/56 (28%), Positives = 32/56 (57%) Frame = -2 Query: 579 GEKKLANRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYNTVEWVRYITRAGSYEIR 412 G K P + ++F++ SGL+V L ++ + Y + V+Y+T+AG +++R Sbjct: 363 GAPKPEENPSLNIQFKIQQLAISGLKVNRLDMYGEK-YKPFKGVKYVTKAGKFQVR 417
>AP3M1_MOUSE (Q9JKC8) AP-3 complex subunit mu-1 (Adapter-related protein complex| 3 mu-1 subunit) (Mu-adaptin 3A) (AP-3 adapter complex mu3A subunit) Length = 418 Score = 36.6 bits (83), Expect = 0.066 Identities = 16/56 (28%), Positives = 32/56 (57%) Frame = -2 Query: 579 GEKKLANRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYNTVEWVRYITRAGSYEIR 412 G K P + ++F++ SGL+V L ++ + Y + V+Y+T+AG +++R Sbjct: 363 GAPKPEENPNLNIQFKIQQLAISGLKVNRLDMYGEK-YKPFKGVKYVTKAGKFQVR 417
>GALT6_CAEEL (O61394) Probable N-acetylgalactosaminyltransferase 6 (EC 2.4.1.-)| (Protein-UDP acetylgalactosaminyltransferase 6) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 6) (pp-GaNTase 6) Length = 618 Score = 30.4 bits (67), Expect = 4.8 Identities = 23/66 (34%), Positives = 30/66 (45%), Gaps = 7/66 (10%) Frame = +1 Query: 208 GGRIHI-PCQHENKEHRKTACSDLPSAGVQTHRELGHNLRAF*SIMMRT------KRAPQ 366 GGR+ I PC H RK++ D P G + + L NL + M K APQ Sbjct: 373 GGRVEILPCSHVGHVFRKSSPHDFP--GKSSGKVLNTNLLRVAEVWMDDWKHYFYKIAPQ 430 Query: 367 IHEIRS 384 H +RS Sbjct: 431 AHRMRS 436
>WBS14_CAEEL (P41846) WBSCR14 protein homolog (Mlx interactor)| Length = 1009 Score = 30.4 bits (67), Expect = 4.8 Identities = 17/64 (26%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = +2 Query: 86 PFDTHSRRKQQELARGVLIN-ENKCYSQIYNKKYAL*HKQDTGGEYISRVNMKIRNIGKL 262 P S+RK+QE A L+N + C + N K A+ ++ +G Y+ +++ + K Sbjct: 716 PPSASSKRKEQEAAMAPLVNRQQSCDVNLLNGKMAVKVEEKSGRHYLPTTPTELKEVTKE 775 Query: 263 PALI 274 L+ Sbjct: 776 EPLL 779
>ACRBP_HUMAN (Q8NEB7) Acrosin-binding protein precursor (Proacrosin-binding| protein sp32) (Cancer testis antigen OY-TES-1) Length = 543 Score = 29.6 bits (65), Expect = 8.1 Identities = 17/45 (37%), Positives = 26/45 (57%) Frame = +3 Query: 492 GTEHVNQKQ*TSEPGIPSESVACSLTSFPPL*RSVQLLHFIVASV 626 G E V+Q Q SEP SES++ + +SF P R V+ I+ ++ Sbjct: 241 GREAVSQLQTDSEPKFHSESLSSNPSSFAPRVREVESTPMIMENI 285
>AMPL3_ARATH (Q944P7) Leucine aminopeptidase 3, chloroplast precursor (EC| 3.4.11.1) (LAP 3) (Leucyl aminopeptidase 3) (Proline aminopeptidase 3) (EC 3.4.11.5) (Prolyl aminopeptidase 3) Length = 583 Score = 29.6 bits (65), Expect = 8.1 Identities = 16/64 (25%), Positives = 31/64 (48%), Gaps = 4/64 (6%) Frame = -3 Query: 551 RFRWNSRFRCSLLLVYVFGSSRCGRRVATTPLSGFATSQGLDHMKSGVSDQE----KWRG 384 RF++ SR R + + ++ SSR + G + +DH K S +E +W+G Sbjct: 34 RFQFPSRLRLAFAVTPLYSSSRAMAHTISHATLGLTQANSVDHPKISFSGKEIDVTEWKG 93 Query: 383 LLIS 372 +++ Sbjct: 94 DILA 97 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 104,026,395 Number of Sequences: 219361 Number of extensions: 2370818 Number of successful extensions: 4810 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 4671 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4795 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6143359464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)