| Clone Name | rbags19l13 |
|---|---|
| Clone Library Name | barley_pub |
>SYFA_AQUAE (O67087) Phenylalanyl-tRNA synthetase alpha chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase alpha chain) (PheRS) Length = 338 Score = 36.2 bits (82), Expect = 0.093 Identities = 27/76 (35%), Positives = 44/76 (57%), Gaps = 1/76 (1%) Frame = -3 Query: 500 LSEFDLDLQE-KVLLAIRSLLKLPLTDARDFESCGLDSVLYRLGVQLEELPSEEQKEYAG 324 + + D L+E K+LL+ S LK L + R + G V+ L +++E+PSEE+KEY Sbjct: 1 MEKLDKILEELKLLLSSVSSLK-ELQEVRS-KFLGSKGVIKELLKKIKEVPSEERKEYGK 58 Query: 323 EVDALRREVLMLFEQK 276 V+ L+ E L ++K Sbjct: 59 RVNLLKEEAEKLIKEK 74
>SIL1_XENLA (Q6NUA7) Nucleotide exchange factor SIL1 precursor| Length = 456 Score = 35.4 bits (80), Expect = 0.16 Identities = 26/75 (34%), Positives = 42/75 (56%) Frame = -3 Query: 512 VTDMLSEFDLDLQEKVLLAIRSLLKLPLTDARDFESCGLDSVLYRLGVQLEELPSEEQKE 333 ++D+L + D +EKVL A+ +L+ PL A + C L ++L L + E L +EE + Sbjct: 377 ISDLLRLPENDSREKVLKAVLTLI--PLCRAEFLKDCNLLTLLNSLRKEYEGLAAEELR- 433 Query: 332 YAGEVDALRREVLML 288 +GE D E+L L Sbjct: 434 -SGEQDGYFSEILSL 447
>MYOC_RABIT (Q866N2) Myocilin precursor (Trabecular meshwork-induced| glucocorticoid response protein) Length = 490 Score = 34.7 bits (78), Expect = 0.27 Identities = 30/110 (27%), Positives = 47/110 (42%), Gaps = 5/110 (4%) Frame = -3 Query: 497 SEFDLDLQEKVLLAIRSLLKLPLTDARDFESC-----GLDSVLYRLGVQLEELPSEEQKE 333 SE Q + + AI+ L + T D ES L+S+L+RL + P E Q+E Sbjct: 43 SESSCPEQGQTMSAIQDLQRDSSTQRADLESTKARLSSLESLLHRLTLAQTSGPQEIQEE 102 Query: 332 YAGEVDALRREVLMLFEQKLKLGXXXXXXXXXXXTDEEKRSRRFRSSDSV 183 E+ LRRE L Q +L EE++ R + ++ + Sbjct: 103 LQKELGTLRRERDQLESQTRELEAAYSNLLRDKSALEEEKRRLMQENEDL 152
>LRRC4_HUMAN (Q9HBW1) Leucine-rich repeat-containing protein 4 precursor (Brain| tumor-associated protein LRRC4) (NAG14) Length = 653 Score = 30.0 bits (66), Expect = 6.7 Identities = 13/29 (44%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = +2 Query: 170 TWQPAL-SHWIENAYFSSLHPCVLSMTPP 253 T++PA +HW EN+ +SLHP V +++ P Sbjct: 609 TYKPAHGAHWTENSLGNSLHPTVTTISEP 637
>ARGR1_BACCR (Q81II2) Arginine repressor 1| Length = 149 Score = 30.0 bits (66), Expect = 6.7 Identities = 20/76 (26%), Positives = 40/76 (52%), Gaps = 2/76 (2%) Frame = -3 Query: 512 VTDMLSEFDLDLQEKV--LLAIRSLLKLPLTDARDFESCGLDSVLYRLGVQLEELPSEEQ 339 + + E+++D QE++ LLA + +L T +RD L V + G+ + ++ SEE Sbjct: 10 IKQFVKEYEIDKQERLVELLAKKDVLVTQATVSRDIRELNLTKVPSQEGLMIYKVFSEEH 69 Query: 338 KEYAGEVDALRREVLM 291 + ++ REV++ Sbjct: 70 LQTDIKLKKKLREVVV 85
>LRRC4_MOUSE (Q99PH1) Leucine-rich repeat-containing 4 protein precursor (Brain| tumor-associated protein MBAG1) Length = 652 Score = 30.0 bits (66), Expect = 6.7 Identities = 13/29 (44%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = +2 Query: 170 TWQPAL-SHWIENAYFSSLHPCVLSMTPP 253 T++PA +HW EN+ +SLHP V +++ P Sbjct: 608 TYKPAHGAHWTENSLGNSLHPTVTTISEP 636
>ZO1_MOUSE (P39447) Tight junction protein ZO-1 (Zonula occludens 1 protein)| (Zona occludens 1 protein) (Tight junction protein 1) Length = 1745 Score = 29.6 bits (65), Expect = 8.7 Identities = 18/62 (29%), Positives = 29/62 (46%) Frame = +2 Query: 83 YNRYKPPAKVRRDSTWQPDSFQK*STLSKTWQPALSHWIENAYFSSLHPCVLSMTPPRQR 262 + R++ PA + DS + + + STL QPA ++ + N Y P S T P+ Sbjct: 1128 FQRFEEPAPLSYDSRTRYEQLPRTSTLRHEEQPAPAYEVHNRYRPEAQP--YSSTGPKSS 1185 Query: 263 YP 268 P Sbjct: 1186 EP 1187 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 90,946,199 Number of Sequences: 219361 Number of extensions: 1761829 Number of successful extensions: 3992 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3893 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3989 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6598423128 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)