| Clone Name | rbags19l10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CP84_BP186 (P41062) Hypothetical 37.8 kDa protein in GPA 5'region | 31 | 3.4 | 2 | GSPF_ERWCH (P31704) General secretion pathway protein F (Pectic ... | 30 | 5.7 | 3 | AROK_PSEAE (P34003) Shikimate kinase (EC 2.7.1.71) (SK) | 29 | 9.8 |
|---|
>CP84_BP186 (P41062) Hypothetical 37.8 kDa protein in GPA 5'region| Length = 334 Score = 30.8 bits (68), Expect = 3.4 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = -1 Query: 346 ATQSISRILSWHGNRCYKAPGRSSFSPWDSDLDGQP 239 A + ++ W G R ++P R++ W+ D D P Sbjct: 155 ALEKYDEVILWQGVRAQESPARAALPMWEEDADNTP 190
>GSPF_ERWCH (P31704) General secretion pathway protein F (Pectic enzymes| secretion protein outF) Length = 404 Score = 30.0 bits (66), Expect = 5.7 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = -2 Query: 345 LHNQYPGFSAGMATDAIRRPADLHSAL 265 L N Y F G ATDA+R LH AL Sbjct: 299 LTNDYARFRLGQATDAVREGVTLHKAL 325
>AROK_PSEAE (P34003) Shikimate kinase (EC 2.7.1.71) (SK)| Length = 172 Score = 29.3 bits (64), Expect = 9.8 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +3 Query: 363 DRHRTASDEDKPLALLHEIWILRDPLYFPVLDV 461 DR+R + P +L ++ LRDPLY + DV Sbjct: 114 DRNRPLLQKPNPGQILRDLMALRDPLYREIADV 146 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 87,018,880 Number of Sequences: 219361 Number of extensions: 1745803 Number of successful extensions: 3852 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3747 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3849 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5653129581 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)