ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbags19l07 |
|---|---|
| Clone Library Name | barley_pub |
>RBS3_WHEAT (P07398) Ribulose bisphosphate carboxylase small chain clone 512| (EC 4.1.1.39) (RuBisCO small subunit) (Fragment) Length = 113 Score = 65.9 bits (159), Expect = 3e-11 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPGXXESGKA 135 KEYPDAYVRII NMRQVQCV F AFKPPG ESGKA Sbjct: 76 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESGKA 113
>RBS_HORVU (Q40004) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 174 Score = 65.9 bits (159), Expect = 3e-11 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPGXXESGKA 135 KEYPDAYVRII NMRQVQCV F AFKPPG ESGKA Sbjct: 137 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCQESGKA 174
>RBS2_WHEAT (P26667) Ribulose bisphosphate carboxylase small chain PW9,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PW9) Length = 175 Score = 64.3 bits (155), Expect = 8e-11 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPGXXESGKA 135 KEYPDAYVR+I NMRQVQCV F AF+PPG ESGKA Sbjct: 138 KEYPDAYVRVIGFDNMRQVQCVSFIAFRPPGCEESGKA 175
>RBS1_WHEAT (P00871) Ribulose bisphosphate carboxylase small chain PWS4.3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PWS4.3) Length = 174 Score = 63.2 bits (152), Expect = 2e-10 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPGXXESGKA 135 KEYPDAYVR+I N+RQVQCV F AF+PPG ESGKA Sbjct: 137 KEYPDAYVRVIGFDNLRQVQCVSFIAFRPPGCEESGKA 174
>RBS_AEGTA (Q38793) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 175 Score = 55.1 bits (131), Expect = 5e-08 Identities = 27/38 (71%), Positives = 27/38 (71%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPGXXESGKA 135 KEYPD Y RII NMRQVQ V F A KPPG ESGKA Sbjct: 138 KEYPDPYCRIIGFDNMRQVQSVSFIASKPPGCEESGKA 175
>RBS3_ORYSA (P18567) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 175 Score = 51.6 bits (122), Expect = 5e-07 Identities = 23/36 (63%), Positives = 27/36 (75%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPGXXESG 141 K YPDA+VRII N+RQVQ + F A+KPPG ESG Sbjct: 138 KAYPDAFVRIIGFDNVRQVQLISFIAYKPPGCEESG 173
>RBS2_ORYSA (P18566) Ribulose bisphosphate carboxylase small chain A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit A) Length = 175 Score = 51.2 bits (121), Expect = 7e-07 Identities = 22/36 (61%), Positives = 27/36 (75%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPGXXESG 141 K YPDA++RII N+RQVQ + F A+KPPG ESG Sbjct: 138 KAYPDAFIRIIGFDNVRQVQLISFIAYKPPGCEESG 173
>RBS3_AMAHP (Q9XGX4) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 180 Score = 48.9 bits (115), Expect = 3e-06 Identities = 21/31 (67%), Positives = 23/31 (74%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 K YP A++RII N RQVQCV F AFKPPG Sbjct: 149 KAYPSAFIRIIGFDNKRQVQCVSFIAFKPPG 179
>RBS3B_ARATH (P10798) Ribulose bisphosphate carboxylase small chain 3B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3B) Length = 181 Score = 48.9 bits (115), Expect = 3e-06 Identities = 20/35 (57%), Positives = 25/35 (71%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPGXXES 144 KEYP A++RII N RQVQC+ F A+KPP E+ Sbjct: 147 KEYPGAFIRIIGFDNTRQVQCISFIAYKPPSFTEA 181
>RBS2B_ARATH (P10797) Ribulose bisphosphate carboxylase small chain 2B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2B) Length = 181 Score = 48.9 bits (115), Expect = 3e-06 Identities = 20/35 (57%), Positives = 25/35 (71%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPGXXES 144 KEYP A++RII N RQVQC+ F A+KPP E+ Sbjct: 147 KEYPGAFIRIIGFDNTRQVQCISFIAYKPPSFTEA 181
>RBS_SINAL (P13951) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) (Fragment) Length = 82 Score = 48.1 bits (113), Expect = 6e-06 Identities = 19/35 (54%), Positives = 26/35 (74%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPGXXES 144 KEYP+A++RII N RQVQC+ F A+KPP ++ Sbjct: 48 KEYPNAFIRIIGFDNNRQVQCISFIAYKPPSFTDA 82
>RBS2_PETHY (P04715) Ribulose bisphosphate carboxylase small chain SSU11A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU11A) Length = 180 Score = 48.1 bits (113), Expect = 6e-06 Identities = 19/31 (61%), Positives = 25/31 (80%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 K YP+A++RII N+RQVQC+ F A+KPPG Sbjct: 149 KAYPNAWIRIIGFDNVRQVQCISFIAYKPPG 179
>RBS1_PETHY (P04714) Ribulose bisphosphate carboxylase small chain SSU8,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU8) Length = 180 Score = 48.1 bits (113), Expect = 6e-06 Identities = 19/31 (61%), Positives = 25/31 (80%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 K YP+A++RII N+RQVQC+ F A+KPPG Sbjct: 149 KAYPNAWIRIIGFDNVRQVQCISFIAYKPPG 179
>RBS1B_ARATH (P10796) Ribulose bisphosphate carboxylase small chain 1B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1B) Length = 181 Score = 47.8 bits (112), Expect = 8e-06 Identities = 19/35 (54%), Positives = 25/35 (71%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPGXXES 144 KEYP A++RII N RQVQC+ F A+KPP ++ Sbjct: 147 KEYPGAFIRIIGFDNTRQVQCISFIAYKPPSFTDA 181
>RBS_MANES (Q42915) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 47.8 bits (112), Expect = 8e-06 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 K +PD Y RII N+RQVQC+ F A+KPPG Sbjct: 151 KHHPDGYARIIGFDNVRQVQCISFLAYKPPG 181
>RBS_GOSHI (P31333) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 47.8 bits (112), Expect = 8e-06 Identities = 19/31 (61%), Positives = 25/31 (80%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 KEYP+A++RII N+RQVQC+ F A+KP G Sbjct: 151 KEYPNAFIRIIGFDNVRQVQCISFIAYKPKG 181
>RBS1A_ARATH (P10795) Ribulose bisphosphate carboxylase small chain 1A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1A) Length = 180 Score = 47.8 bits (112), Expect = 8e-06 Identities = 19/30 (63%), Positives = 24/30 (80%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPP 159 KEYP+A++RII N RQVQC+ F A+KPP Sbjct: 147 KEYPNAFIRIIGFDNTRQVQCISFIAYKPP 176
>RBS_CUCSA (P08474) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 189 Score = 47.4 bits (111), Expect = 1e-05 Identities = 18/29 (62%), Positives = 24/29 (82%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKP 162 KEYPDA++R+I N+RQVQC+ F A+KP Sbjct: 151 KEYPDAFIRVIGFDNVRQVQCISFIAYKP 179
>RBS_LACSA (Q40250) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 47.0 bits (110), Expect = 1e-05 Identities = 18/31 (58%), Positives = 24/31 (77%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 KEYP+A++R+I N+RQVQC+ F KPPG Sbjct: 149 KEYPNAFIRVIGFDNIRQVQCISFIVAKPPG 179
>RBS_RAPSA (P08135) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 46.6 bits (109), Expect = 2e-05 Identities = 19/35 (54%), Positives = 25/35 (71%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPGXXES 144 KEYP+A +RII N RQVQC+ F A+KPP ++ Sbjct: 147 KEYPNALIRIIGFDNNRQVQCISFIAYKPPSFTDA 181
>RBS_MUSAC (O24045) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 45.8 bits (107), Expect = 3e-05 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 KEYP A++RII N RQVQC+ F A+KP G Sbjct: 149 KEYPHAFIRIIGFDNNRQVQCISFIAYKPTG 179
>RBS_MAIZE (P05348) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 170 Score = 45.8 bits (107), Expect = 3e-05 Identities = 18/31 (58%), Positives = 23/31 (74%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 K YPDA+ R+I N++Q QCV F A+KPPG Sbjct: 138 KSYPDAFHRVIGFDNIKQTQCVSFIAYKPPG 168
>RBS_FLATR (P07089) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 173 Score = 45.4 bits (106), Expect = 4e-05 Identities = 20/31 (64%), Positives = 23/31 (74%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 KEYP A++RII N+RQVQCV F A KP G Sbjct: 142 KEYPQAWIRIIGFDNVRQVQCVSFIASKPTG 172
>RBS2_BRANA (P27985) Ribulose bisphosphate carboxylase small chain F1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit F1) Length = 181 Score = 45.4 bits (106), Expect = 4e-05 Identities = 18/29 (62%), Positives = 23/29 (79%) Frame = -2 Query: 245 EYPDAYVRIIXXXNMRQVQCVXFXAFKPP 159 EYP+A++RII N RQVQC+ F A+KPP Sbjct: 148 EYPNAFIRIIGFDNNRQVQCISFIAYKPP 176
>RBS1_BRANA (P05346) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 45.4 bits (106), Expect = 4e-05 Identities = 18/29 (62%), Positives = 23/29 (79%) Frame = -2 Query: 245 EYPDAYVRIIXXXNMRQVQCVXFXAFKPP 159 EYP+A++RII N RQVQC+ F A+KPP Sbjct: 148 EYPNAFIRIIGFDNNRQVQCISFIAYKPP 176
>RBS1_SOYBN (P00865) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 178 Score = 45.4 bits (106), Expect = 4e-05 Identities = 17/29 (58%), Positives = 23/29 (79%) Frame = -2 Query: 242 YPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 YP+ ++RII N+RQVQC+ F A+KPPG Sbjct: 149 YPNGFIRIIGFDNVRQVQCISFIAYKPPG 177
>RBS_HEVBR (P29684) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 45.1 bits (105), Expect = 5e-05 Identities = 19/31 (61%), Positives = 22/31 (70%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 K YPD Y RII N+RQVQC+ F A+KP G Sbjct: 151 KAYPDCYGRIIGFDNVRQVQCISFLAYKPKG 181
>RBS7_FLAPR (Q39749) Ribulose bisphosphate carboxylase small chain 7,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 7) Length = 173 Score = 45.1 bits (105), Expect = 5e-05 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 KEYP A++RII N+RQVQC+ F A KP G Sbjct: 142 KEYPQAWIRIIGFDNVRQVQCISFIASKPDG 172
>RBS5_FLAPR (Q39747) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 173 Score = 45.1 bits (105), Expect = 5e-05 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 KEYP A++RII N+RQVQC+ F A KP G Sbjct: 142 KEYPQAWIRIIGFDNVRQVQCISFIASKPDG 172
>RBS3_FLAPR (Q39745) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 173 Score = 45.1 bits (105), Expect = 5e-05 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 KEYP A++RII N+RQVQC+ F A KP G Sbjct: 142 KEYPQAWIRIIGFDNVRQVQCISFIASKPDG 172
>RBS_STELP (Q41351) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 45.1 bits (105), Expect = 5e-05 Identities = 18/29 (62%), Positives = 23/29 (79%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKP 162 K YPDA++RII N+RQVQC+ F A+KP Sbjct: 149 KAYPDAHIRIIGFDNVRQVQCISFIAYKP 177
>RBS8_NICPL (P26573) Ribulose bisphosphate carboxylase small chain 8B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 8B) Length = 180 Score = 45.1 bits (105), Expect = 5e-05 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 K YP A+VRII N+RQVQC+ F A+KP G Sbjct: 149 KAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 179
>RBS3B_LYCES (P05349) Ribulose bisphosphate carboxylase small chain 3B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3B) Length = 180 Score = 45.1 bits (105), Expect = 5e-05 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 K YP A+VRII N+RQVQC+ F A+KP G Sbjct: 149 KAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 179
>RBS3A_LYCES (P07180) Ribulose bisphosphate carboxylase small chain 3A/3C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3A/3C) Length = 180 Score = 45.1 bits (105), Expect = 5e-05 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 K YP A+VRII N+RQVQC+ F A+KP G Sbjct: 149 KAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 179
>RBS2_SPIOL (Q43832) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 180 Score = 45.1 bits (105), Expect = 5e-05 Identities = 19/31 (61%), Positives = 24/31 (77%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 KEYP+A++RII + RQVQCV F A+KP G Sbjct: 149 KEYPNAFIRIIGFDSNRQVQCVSFIAYKPAG 179
>RBS2A_LYCES (P07179) Ribulose bisphosphate carboxylase small chain 2A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2A) (LESS 5) Length = 180 Score = 45.1 bits (105), Expect = 5e-05 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 K YP A+VRII N+RQVQC+ F A+KP G Sbjct: 149 KAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 179
>RBS1_SOLTU (P26574) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 181 Score = 45.1 bits (105), Expect = 5e-05 Identities = 18/31 (58%), Positives = 23/31 (74%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 K YP A++RII N+RQVQC+ F A+KP G Sbjct: 150 KSYPQAWIRIIGFDNVRQVQCISFIAYKPEG 180
>RBS1_LYCES (P08706) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) (LESS17) Length = 181 Score = 45.1 bits (105), Expect = 5e-05 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 K YP A+VRII N+RQVQC+ F A+KP G Sbjct: 150 KAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 180
>RBS4_FLAPR (Q39746) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 178 Score = 45.1 bits (105), Expect = 5e-05 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 KEYP A++RII N+RQVQC+ F A KP G Sbjct: 147 KEYPQAWIRIIGFDNVRQVQCISFIASKPDG 177
>RBS2_FLAPR (Q39744) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 178 Score = 45.1 bits (105), Expect = 5e-05 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 KEYP A++RII N+RQVQC+ F A KP G Sbjct: 147 KEYPQAWIRIIGFDNVRQVQCISFIASKPEG 177
>RBS3_SOLTU (P32764) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 181 Score = 44.7 bits (104), Expect = 6e-05 Identities = 18/31 (58%), Positives = 23/31 (74%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 K YP A++RII N+RQVQC+ F A+KP G Sbjct: 150 KAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 180
>RBS2_NICSY (P22433) Ribulose bisphosphate carboxylase small chain S41,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit S41) Length = 181 Score = 44.7 bits (104), Expect = 6e-05 Identities = 18/31 (58%), Positives = 23/31 (74%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 K YP A++RII N+RQVQC+ F A+KP G Sbjct: 150 KAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 180
>RBS_GLYTA (Q42823) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 44.7 bits (104), Expect = 6e-05 Identities = 17/28 (60%), Positives = 23/28 (82%) Frame = -2 Query: 242 YPDAYVRIIXXXNMRQVQCVXFXAFKPP 159 YP+A++RII N+RQVQC+ F A+KPP Sbjct: 149 YPNAFIRIIGFDNVRQVQCISFIAYKPP 176
>RBS1_FLAPR (Q39743) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 173 Score = 44.7 bits (104), Expect = 6e-05 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 KEYP A++RII N+RQVQC+ F A KP G Sbjct: 142 KEYPQAWIRIIGFDNVRQVQCISFIASKPGG 172
>RBS_TOBAC (P69249) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) (TSSU3-8) Length = 180 Score = 44.7 bits (104), Expect = 6e-05 Identities = 18/31 (58%), Positives = 23/31 (74%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 K YP A++RII N+RQVQC+ F A+KP G Sbjct: 149 KAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 179
>RBSC_SOLTU (P26577) Ribulose bisphosphate carboxylase small chain 2C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2C) Length = 180 Score = 44.7 bits (104), Expect = 6e-05 Identities = 18/31 (58%), Positives = 23/31 (74%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 K YP A++RII N+RQVQC+ F A+KP G Sbjct: 149 KAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 179
>RBSB_SOLTU (P26576) Ribulose bisphosphate carboxylase small chain 2B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2B) Length = 180 Score = 44.7 bits (104), Expect = 6e-05 Identities = 18/31 (58%), Positives = 23/31 (74%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 K YP A++RII N+RQVQC+ F A+KP G Sbjct: 149 KAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 179
>RBSA_SOLTU (P26575) Ribulose bisphosphate carboxylase small chain 2A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2A) Length = 180 Score = 44.7 bits (104), Expect = 6e-05 Identities = 18/31 (58%), Positives = 23/31 (74%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 K YP A++RII N+RQVQC+ F A+KP G Sbjct: 149 KAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 179
>RBS1_NICSY (P69250) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 44.7 bits (104), Expect = 6e-05 Identities = 18/31 (58%), Positives = 23/31 (74%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 K YP A++RII N+RQVQC+ F A+KP G Sbjct: 149 KAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 179
>RBS1_AMAHP (Q42516) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 183 Score = 44.7 bits (104), Expect = 6e-05 Identities = 19/31 (61%), Positives = 22/31 (70%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 K YP A++RII N RQVQCV F A+KP G Sbjct: 151 KAYPSAFIRIIGFDNKRQVQCVSFIAYKPAG 181
>RBS4_MESCR (Q08184) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 183 Score = 44.3 bits (103), Expect = 8e-05 Identities = 18/29 (62%), Positives = 23/29 (79%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKP 162 K YP+A++RII N+RQVQCV F A+KP Sbjct: 150 KAYPEAFIRIIGFDNVRQVQCVSFIAYKP 178
>RBS5_MESCR (Q08185) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 182 Score = 44.3 bits (103), Expect = 8e-05 Identities = 18/29 (62%), Positives = 23/29 (79%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKP 162 K YP+A++RII N+RQVQCV F A+KP Sbjct: 149 KAYPEAFIRIIGFDNVRQVQCVSFIAYKP 177
>RBS6_MESCR (Q08186) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) Length = 186 Score = 44.3 bits (103), Expect = 8e-05 Identities = 18/29 (62%), Positives = 23/29 (79%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKP 162 K YP+A++RII N+RQVQCV F A+KP Sbjct: 153 KAYPEAFIRIIGFDNVRQVQCVSFIAYKP 181
>RBS1_MESCR (P16032) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 182 Score = 43.9 bits (102), Expect = 1e-04 Identities = 17/29 (58%), Positives = 23/29 (79%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKP 162 K YP+A++RII N+RQVQC+ F A+KP Sbjct: 149 KAYPEAFIRIIGFDNVRQVQCISFIAYKP 177
>RBS_PYRPY (P24007) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 43.9 bits (102), Expect = 1e-04 Identities = 17/31 (54%), Positives = 23/31 (74%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 K YP +++RII N+RQVQC+ F A+KP G Sbjct: 152 KAYPQSFIRIIGFDNVRQVQCISFIAYKPAG 182
>RBS_MALSP (Q02980) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 43.9 bits (102), Expect = 1e-04 Identities = 17/31 (54%), Positives = 23/31 (74%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 K YP +++RII N+RQVQC+ F A+KP G Sbjct: 152 KAYPQSFIRIIGFDNVRQVQCISFIAYKPAG 182
>RBS3_MESCR (Q08183) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 183 Score = 43.9 bits (102), Expect = 1e-04 Identities = 17/29 (58%), Positives = 23/29 (79%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKP 162 K YP+A++RII N+RQVQC+ F A+KP Sbjct: 150 KAYPEAFIRIIGFDNVRQVQCISFIAYKP 178
>RBS_BETVE (Q96542) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 43.5 bits (101), Expect = 1e-04 Identities = 18/31 (58%), Positives = 22/31 (70%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 K YP A++RII N RQVQ + F A+KPPG Sbjct: 151 KAYPSAFIRIIGFDNKRQVQIISFIAYKPPG 181
>RBS_HELAN (P08705) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 43.5 bits (101), Expect = 1e-04 Identities = 18/31 (58%), Positives = 23/31 (74%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 KEYP A++RII N+RQVQC+ F A +P G Sbjct: 147 KEYPQAWIRIIGFDNVRQVQCIMFIASRPDG 177
>RBS0_SOLTU (P10647) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 181 Score = 43.1 bits (100), Expect = 2e-04 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = -2 Query: 242 YPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 YP A++RII N+RQVQC+ F A+KP G Sbjct: 152 YPQAWIRIIGFDNVRQVQCISFIAYKPEG 180
>RBS_GLYTO (Q42822) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 43.1 bits (100), Expect = 2e-04 Identities = 16/28 (57%), Positives = 22/28 (78%) Frame = -2 Query: 242 YPDAYVRIIXXXNMRQVQCVXFXAFKPP 159 YP+ ++RII N+RQVQC+ F A+KPP Sbjct: 149 YPNGFIRIIGFDNVRQVQCISFIAYKPP 176
>RBS4_SOYBN (P12468) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 178 Score = 43.1 bits (100), Expect = 2e-04 Identities = 16/28 (57%), Positives = 22/28 (78%) Frame = -2 Query: 242 YPDAYVRIIXXXNMRQVQCVXFXAFKPP 159 YP+ ++RII N+RQVQC+ F A+KPP Sbjct: 149 YPNGFIRIIGFDNVRQVQCISFIAYKPP 176
>RBS6_FLAPR (Q39748) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) Length = 173 Score = 43.1 bits (100), Expect = 2e-04 Identities = 18/29 (62%), Positives = 22/29 (75%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKP 162 KEYP A++RII N+RQVQC+ F A KP Sbjct: 142 KEYPQAWIRIIGFDNVRQVQCISFIASKP 170
>RBS_FAGCR (O22077) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 43.1 bits (100), Expect = 2e-04 Identities = 17/30 (56%), Positives = 22/30 (73%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPP 159 K YP +++RII N RQVQC+ F A+KPP Sbjct: 151 KTYPTSHIRIIGFDNKRQVQCISFIAYKPP 180
>RBS_SILPR (P18960) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 177 Score = 43.1 bits (100), Expect = 2e-04 Identities = 18/27 (66%), Positives = 21/27 (77%) Frame = -2 Query: 242 YPDAYVRIIXXXNMRQVQCVXFXAFKP 162 YPDA+VRII N RQVQC+ F A+KP Sbjct: 150 YPDAHVRIIGFDNKRQVQCISFIAYKP 176
>RBS_CAPAN (O65349) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 187 Score = 42.7 bits (99), Expect = 2e-04 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKP 162 K YP A++RII N+RQVQC+ F A+KP Sbjct: 149 KAYPQAWIRIIGFDNVRQVQCISFIAYKP 177
>RBS2_MESCR (Q04450) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 180 Score = 42.7 bits (99), Expect = 2e-04 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKP 162 K YP+A+ RII N+RQVQC+ F A+KP Sbjct: 147 KAYPEAFTRIIGFDNVRQVQCISFIAYKP 175
>RBS1_ORYSA (P05347) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 172 Score = 42.4 bits (98), Expect = 3e-04 Identities = 21/36 (58%), Positives = 25/36 (69%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPGXXESG 141 K YPDA+VRII N+RQVQ + F A+ PG ESG Sbjct: 136 KAYPDAFVRIIGFDNVRQVQLISFIAYN-PGCEESG 170
>RBS2_AMAHP (Q9XGX5) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 184 Score = 42.4 bits (98), Expect = 3e-04 Identities = 18/29 (62%), Positives = 21/29 (72%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKP 162 K YP A++RII N RQVQCV F A+KP Sbjct: 152 KAYPTAFIRIIGFDNKRQVQCVSFIAYKP 180
>RBS1_LEMGI (P00872) Ribulose bisphosphate carboxylase small chain SSU1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU1) Length = 173 Score = 41.2 bits (95), Expect = 7e-04 Identities = 17/29 (58%), Positives = 21/29 (72%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKP 162 K YP+ +VRII N RQVQC+ F A+KP Sbjct: 144 KAYPEYFVRIIGFDNKRQVQCISFIAYKP 172
>RBS6_LEMGI (P19312) Ribulose bisphosphate carboxylase small chain SSU5B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU5B) Length = 177 Score = 41.2 bits (95), Expect = 7e-04 Identities = 17/29 (58%), Positives = 21/29 (72%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKP 162 K YP+ +VRII N RQVQC+ F A+KP Sbjct: 148 KAYPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS5_LEMGI (P19311) Ribulose bisphosphate carboxylase small chain SSU5A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU5A) Length = 177 Score = 41.2 bits (95), Expect = 7e-04 Identities = 17/29 (58%), Positives = 21/29 (72%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKP 162 K YP+ +VRII N RQVQC+ F A+KP Sbjct: 148 KAYPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS4_LEMGI (P19310) Ribulose bisphosphate carboxylase small chain SSU40B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU40B) Length = 177 Score = 41.2 bits (95), Expect = 7e-04 Identities = 17/29 (58%), Positives = 21/29 (72%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKP 162 K YP+ +VRII N RQVQC+ F A+KP Sbjct: 148 KAYPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS3_LEMGI (P19309) Ribulose bisphosphate carboxylase small chain SSU40A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU40A) Length = 177 Score = 41.2 bits (95), Expect = 7e-04 Identities = 17/29 (58%), Positives = 21/29 (72%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKP 162 K YP+ +VRII N RQVQC+ F A+KP Sbjct: 148 KAYPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS2_LEMGI (P19308) Ribulose bisphosphate carboxylase small chain SSU26,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU26) Length = 177 Score = 41.2 bits (95), Expect = 7e-04 Identities = 17/29 (58%), Positives = 21/29 (72%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKP 162 K YP+ +VRII N RQVQC+ F A+KP Sbjct: 148 KAYPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS5_FRIAG (O22645) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 179 Score = 40.8 bits (94), Expect = 0.001 Identities = 17/29 (58%), Positives = 21/29 (72%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKP 162 KEYP A++R+I N+RQVQCV F KP Sbjct: 150 KEYPAAFIRVIGFDNVRQVQCVSFIVEKP 178
>RBS3_FRIAG (O22573) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 179 Score = 40.8 bits (94), Expect = 0.001 Identities = 17/29 (58%), Positives = 21/29 (72%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKP 162 KEYP A++R+I N+RQVQCV F KP Sbjct: 150 KEYPAAFIRVIGFDNVRQVQCVSFIVEKP 178
>RBS2_FRIAG (O22572) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 179 Score = 40.8 bits (94), Expect = 0.001 Identities = 17/29 (58%), Positives = 21/29 (72%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKP 162 KEYP A++R+I N+RQVQCV F KP Sbjct: 150 KEYPAAFIRVIGFDNVRQVQCVSFIVEKP 178
>RBS_MEDSA (O65194) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 40.8 bits (94), Expect = 0.001 Identities = 16/28 (57%), Positives = 21/28 (75%) Frame = -2 Query: 245 EYPDAYVRIIXXXNMRQVQCVXFXAFKP 162 EYPD+++RII N+RQVQC+ F A P Sbjct: 150 EYPDSFIRIIGFDNVRQVQCISFIAHTP 177
>RBS_ZANAE (O48550) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 40.4 bits (93), Expect = 0.001 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 K YPD + RII N RQVQC+ F +KP G Sbjct: 147 KAYPDYFNRIIGFDNTRQVQCISFLTYKPEG 177
>RBS_LARLA (P16031) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 189 Score = 40.0 bits (92), Expect = 0.002 Identities = 15/29 (51%), Positives = 21/29 (72%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKP 162 K YP+A++R+I N+RQVQC+ F KP Sbjct: 158 KAYPNAFIRVIGFDNVRQVQCISFIVHKP 186
>RBS_TRIRP (P17673) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 40.0 bits (92), Expect = 0.002 Identities = 16/28 (57%), Positives = 21/28 (75%) Frame = -2 Query: 245 EYPDAYVRIIXXXNMRQVQCVXFXAFKP 162 EYP+A++RII N+RQVQC+ F A P Sbjct: 148 EYPEAFIRIIGFDNVRQVQCISFIASTP 175
>RBS1_FRIAG (O24634) Ribulose bisphosphate carboxylase small chain 1/4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1/4) Length = 179 Score = 39.7 bits (91), Expect = 0.002 Identities = 16/29 (55%), Positives = 21/29 (72%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKP 162 KEYP A++R+I N+RQVQCV F +P Sbjct: 150 KEYPAAFIRVIGFDNVRQVQCVSFIVERP 178
>RBS_PINTH (P10053) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 171 Score = 39.3 bits (90), Expect = 0.003 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKP 162 K YP A++R+I N+RQVQC+ F KP Sbjct: 142 KAYPKAFIRVIGFDNVRQVQCISFIVHKP 170
>RBS1_PEA (P00868) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) (PSSU1) (Fragment) Length = 136 Score = 38.5 bits (88), Expect = 0.005 Identities = 15/27 (55%), Positives = 20/27 (74%) Frame = -2 Query: 242 YPDAYVRIIXXXNMRQVQCVXFXAFKP 162 YP+A+VR+I N+RQVQC+ F A P Sbjct: 107 YPEAFVRVIGFNNVRQVQCISFIAHTP 133
>RBS1_SPIOL (P00870) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 123 Score = 38.5 bits (88), Expect = 0.005 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPG 156 K PDA+VR I + R+VQC+ F A+KP G Sbjct: 92 KAPPDAFVRFIGFNDKREVQCISFIAYKPAG 122
>RBS3_PEA (P07689) Ribulose bisphosphate carboxylase small chain 3A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3A) Length = 180 Score = 38.1 bits (87), Expect = 0.006 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = -2 Query: 242 YPDAYVRIIXXXNMRQVQCVXFXAFKP 162 YP A+VRII N+RQVQC+ F A P Sbjct: 151 YPQAFVRIIGFDNVRQVQCISFIAHTP 177
>RBS2_PEA (P00869) Ribulose bisphosphate carboxylase small chain 3C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3C) (PSS15) Length = 180 Score = 38.1 bits (87), Expect = 0.006 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = -2 Query: 242 YPDAYVRIIXXXNMRQVQCVXFXAFKP 162 YP A+VRII N+RQVQC+ F A P Sbjct: 151 YPQAFVRIIGFDNVRQVQCISFIAHTP 177
>RBS_CYAPA (P18062) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 106 Score = 34.3 bits (77), Expect = 0.087 Identities = 11/29 (37%), Positives = 22/29 (75%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKP 162 +++P+AY+R++ ++RQVQ + F +KP Sbjct: 77 QQFPNAYIRVVAFDSIRQVQTLMFLVYKP 105
>RBS_SYNP2 (Q44178) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 111 Score = 33.9 bits (76), Expect = 0.11 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -2 Query: 245 EYPDAYVRIIXXXNMRQVQCVXFXAFKP 162 EY D Y+R++ N++Q Q V F +KP Sbjct: 79 EYSDCYIRVVGFDNIKQCQTVSFIVYKP 106
>RBS_CHLMO (P17537) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 168 Score = 33.5 bits (75), Expect = 0.15 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -2 Query: 242 YPDAYVRIIXXXNMRQVQCVXFXAFKPPGXXE 147 +P+ Y+R++ N++QVQC+ F +P E Sbjct: 128 FPNVYIRLVAFDNVKQVQCMGFLVQRPRNAAE 159
>RBS2_CHLRE (P08475) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 185 Score = 33.5 bits (75), Expect = 0.15 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKP 162 K +PDAYVR++ N +QVQ + F +P Sbjct: 143 KAFPDAYVRLVAFDNQKQVQIMGFLVQRP 171
>RBS1_CHLRE (P00873) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 185 Score = 33.5 bits (75), Expect = 0.15 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKP 162 K +PDAYVR++ N +QVQ + F +P Sbjct: 143 KAFPDAYVRLVAFDNQKQVQIMGFLVQRP 171
>RBS_PROHO (P27569) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 109 Score = 33.5 bits (75), Expect = 0.15 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -2 Query: 245 EYPDAYVRIIXXXNMRQVQCVXFXAFKP 162 EYP+ Y+R++ N++Q Q V F KP Sbjct: 79 EYPNCYIRVVGFDNIKQCQSVSFIVHKP 106
>RBS7_ACECL (Q38693) Ribulose bisphosphate carboxylase small chain 7,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 7) (rbcS1) Length = 183 Score = 33.1 bits (74), Expect = 0.19 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPGXXE 147 K +PDAY+R++ RQVQ F +PP + Sbjct: 141 KAFPDAYIRLVCFDANRQVQICGFLVHRPPSATD 174
>RBS2_ACECL (P16130) Ribulose bisphosphate carboxylase small chain 2 (EC| 4.1.1.39) (RuBisCO small subunit 2) (Fragment) Length = 86 Score = 32.7 bits (73), Expect = 0.25 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPGXXE 147 K +PDAY+R++ RQVQ F +PP + Sbjct: 44 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 77
>RBS6_ACECL (Q38692) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) (rbcS4) Length = 182 Score = 32.7 bits (73), Expect = 0.25 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPGXXE 147 K +PDAY+R++ RQVQ F +PP + Sbjct: 140 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS4_ACECL (P16132) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 182 Score = 32.7 bits (73), Expect = 0.25 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPGXXE 147 K +PDAY+R++ RQVQ F +PP + Sbjct: 140 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS3_ACEME (P16136) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 182 Score = 32.7 bits (73), Expect = 0.25 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPGXXE 147 K +PDAY+R++ RQVQ F +PP + Sbjct: 140 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS2_ACEME (P16135) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) (Fragment) Length = 173 Score = 32.7 bits (73), Expect = 0.25 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPGXXE 147 K +PDAY+R++ RQVQ F +PP + Sbjct: 131 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 164
>RBS1_ACEME (P16134) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 182 Score = 32.7 bits (73), Expect = 0.25 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPGXXE 147 K +PDAY+R++ RQVQ F +PP + Sbjct: 140 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS3_ACECL (P16131) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 183 Score = 32.7 bits (73), Expect = 0.25 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPGXXE 147 K +PDAY+R++ RQVQ F +PP + Sbjct: 141 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 174
>RBS1_ACECL (P16129) Ribulose bisphosphate carboxylase small chain 1 (EC| 4.1.1.39) (RuBisCO small subunit 1) (Fragment) Length = 126 Score = 32.7 bits (73), Expect = 0.25 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPGXXE 147 K +PDAY+R++ RQVQ F +PP + Sbjct: 84 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 117
>RBS5_ACECL (P16133) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 184 Score = 32.0 bits (71), Expect = 0.43 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPP 159 K +PDAY+R++ RQVQ F +PP Sbjct: 142 KAFPDAYIRLVCFDANRQVQISGFLVHRPP 171
>RBS_EUGGR (P16881) Ribulose bisphosphate carboxylase small chains, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunits) [Contains: Ribulose bisphosphate carboxylase small chain P1; Ribulose bisphosphate carboxylase small chain P2; Ribulose bispho Length = 1273 Score = 31.6 bits (70), Expect = 0.57 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPGXXES 144 + YP YVR+ +++QVQ + F +P G S Sbjct: 1094 RAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 1128 Score = 31.6 bits (70), Expect = 0.57 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPGXXES 144 + YP YVR+ +++QVQ + F +P G S Sbjct: 806 RAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 840 Score = 31.6 bits (70), Expect = 0.57 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPGXXES 144 + YP YVR+ +++QVQ + F +P G S Sbjct: 663 RAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 697 Score = 31.6 bits (70), Expect = 0.57 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPGXXES 144 + YP YVR+ +++QVQ + F +P G S Sbjct: 519 RAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 553 Score = 31.6 bits (70), Expect = 0.57 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPGXXES 144 + YP YVR+ +++QVQ + F +P G S Sbjct: 376 RAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 410 Score = 31.6 bits (70), Expect = 0.57 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPGXXES 144 + YP YVR+ +++QVQ + F +P G S Sbjct: 232 RAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 266 Score = 28.5 bits (62), Expect = 4.8 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPGXXES 144 + YP YVR+ +++QVQ + F +P S Sbjct: 1238 RAYPQCYVRLAAFDSVKQVQVISFVVQRPSSGGRS 1272
>RBS4_ACEME (P16137) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 182 Score = 31.2 bits (69), Expect = 0.74 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -2 Query: 242 YPDAYVRIIXXXNMRQVQCVXFXAFKPPGXXE 147 +PDAY+R++ RQVQ F +PP + Sbjct: 142 FPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS5_ACEME (P16138) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 183 Score = 31.2 bits (69), Expect = 0.74 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -2 Query: 242 YPDAYVRIIXXXNMRQVQCVXFXAFKPPGXXE 147 +PDAY+R++ RQVQ F +PP + Sbjct: 143 FPDAYIRLVCFDANRQVQISGFLVHRPPSATD 174
>RBS_BATOE (P26985) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 175 Score = 29.6 bits (65), Expect = 2.2 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -2 Query: 248 KEYPDAYVRIIXXXNMRQVQCVXFXAFKPPGXXE 147 K +PDAY+R++ RQVQ F +P + Sbjct: 133 KAFPDAYIRLVCFDANRQVQISGFLVHRPESATD 166
>RBS_ANASP (P06514) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 109 Score = 29.6 bits (65), Expect = 2.2 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -2 Query: 245 EYPDAYVRIIXXXNMRQVQCVXFXAFKP 162 +YP Y+R++ N++Q Q + F KP Sbjct: 79 QYPGHYIRVVGFDNIKQCQILSFIVHKP 106
>RBS_SYNP6 (P04716) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 110 Score = 29.3 bits (64), Expect = 2.8 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 245 EYPDAYVRIIXXXNMRQVQCVXFXAFKP 162 EY D Y+R+ N++Q Q V F +P Sbjct: 80 EYGDCYIRVAGFDNIKQCQTVSFIVHRP 107
>TLPB_BACSU (P39217) Methyl-accepting chemotaxis protein tlpB| Length = 662 Score = 28.5 bits (62), Expect = 4.8 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +1 Query: 37 KNRXMEKENPKQCQS*QNCNGTLYXAHRQ*AVYALPDSXXPGG 165 KN+ + KE KQ + + G +Y A +Y PDS P G Sbjct: 89 KNKTLLKEKFKQYTTLNDDVGAIYAASEDKKLYKYPDSGVPKG 131 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,494,512 Number of Sequences: 219361 Number of extensions: 331591 Number of successful extensions: 512 Number of sequences better than 10.0: 111 Number of HSP's better than 10.0 without gapping: 502 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 512 length of database: 80,573,946 effective HSP length: 58 effective length of database: 67,851,008 effective search space used: 1628424192 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
