| Clone Name | rbags19l01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ANM3_HUMAN (O60678) Protein arginine N-methyltransferase 3 (EC 2... | 32 | 1.4 | 2 | OPSD_CAMAB (Q17292) Rhodopsin | 32 | 1.4 | 3 | ANM3_MOUSE (Q922H1) Protein arginine N-methyltransferase 3 (EC 2... | 32 | 1.8 | 4 | ANM3_RAT (O70467) Protein arginine N-methyltransferase 3 (EC 2.1... | 31 | 2.4 | 5 | OPSD_CATBO (Q17296) Rhodopsin | 31 | 3.2 | 6 | OPSD_APIME (Q17053) Rhodopsin, long-wavelength (Opsin, green-sen... | 30 | 4.1 |
|---|
>ANM3_HUMAN (O60678) Protein arginine N-methyltransferase 3 (EC 2.1.1.-)| (Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 3) Length = 531 Score = 32.0 bits (71), Expect = 1.4 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = -1 Query: 574 NSIVLSTGPDSR--YWKQGVQLLSKPIEVNPAKS 479 N +V STGP S +WKQ V LL KP V ++ Sbjct: 465 NRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEA 498
>OPSD_CAMAB (Q17292) Rhodopsin| Length = 378 Score = 32.0 bits (71), Expect = 1.4 Identities = 20/72 (27%), Positives = 33/72 (45%), Gaps = 3/72 (4%) Frame = +3 Query: 345 YLYLVQFLVCVVMHEVP*CNLRQENEEQNVMSPEEGSNDASTCNCDLAGFTSMGL---LR 515 Y +++Q V HE N+R++ ++ NV S N +++ C LA M + Sbjct: 238 YFFIIQ---AVAAHEK---NMREQAKKMNVASLRSAENQSTSAECKLAKVALMTISLWFM 291 Query: 516 SWTPCFQYRLSG 551 +WTP SG Sbjct: 292 AWTPYLVINYSG 303
>ANM3_MOUSE (Q922H1) Protein arginine N-methyltransferase 3 (EC 2.1.1.-)| (Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 3) Length = 532 Score = 31.6 bits (70), Expect = 1.8 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = -1 Query: 574 NSIVLSTGPDSR--YWKQGVQLLSKPIEVNPAKS 479 N +V STGP S +WKQ V LL KP V ++ Sbjct: 466 NRVVFSTGPQSTKTHWKQTVFLLEKPFPVKAGEA 499
>ANM3_RAT (O70467) Protein arginine N-methyltransferase 3 (EC 2.1.1.-)| (Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 3) Length = 528 Score = 31.2 bits (69), Expect = 2.4 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = -1 Query: 574 NSIVLSTGPDSR--YWKQGVQLLSKPIEVNPAKS 479 N +V STGP S +WKQ + LL KP V ++ Sbjct: 462 NRVVFSTGPQSTKTHWKQTIFLLEKPFPVKAGEA 495
>OPSD_CATBO (Q17296) Rhodopsin| Length = 378 Score = 30.8 bits (68), Expect = 3.2 Identities = 19/72 (26%), Positives = 33/72 (45%), Gaps = 3/72 (4%) Frame = +3 Query: 345 YLYLVQFLVCVVMHEVP*CNLRQENEEQNVMSPEEGSNDASTCNCDLAGFTSMGL---LR 515 Y +++Q V HE N+R++ ++ NV S N +++ C LA M + Sbjct: 238 YFFIIQ---AVAAHEK---NMREQAKKMNVASLRSAENQSTSAECKLAKVALMTISLWFM 291 Query: 516 SWTPCFQYRLSG 551 +WTP +G Sbjct: 292 AWTPYLVINYAG 303
>OPSD_APIME (Q17053) Rhodopsin, long-wavelength (Opsin, green-sensitive)| Length = 377 Score = 30.4 bits (67), Expect = 4.1 Identities = 20/72 (27%), Positives = 32/72 (44%), Gaps = 3/72 (4%) Frame = +3 Query: 345 YLYLVQFLVCVVMHEVP*CNLRQENEEQNVMSPEEGSNDASTCNCDLAGFTSMGL---LR 515 Y +++Q V HE N+R++ ++ NV S N ++ C LA M + Sbjct: 236 YWFIIQ---AVAAHEK---NMREQAKKMNVASLRSSENQNTSAECKLAKVALMTISLWFM 289 Query: 516 SWTPCFQYRLSG 551 +WTP SG Sbjct: 290 AWTPYLVINFSG 301 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 94,505,035 Number of Sequences: 219361 Number of extensions: 2050095 Number of successful extensions: 4073 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3990 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4073 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5310515667 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)