| Clone Name | rbags19k23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RETST_RAT (Q8VHE9) All-trans-retinol 13,14-reductase precursor (... | 29 | 9.9 | 2 | RETST_MOUSE (Q64FW2) All-trans-retinol 13,14-reductase precursor... | 29 | 9.9 |
|---|
>RETST_RAT (Q8VHE9) All-trans-retinol 13,14-reductase precursor (EC 1.3.99.23)| (All-trans-13,14-dihydroretinol saturase) (RetSat) (RMT-7) Length = 609 Score = 28.9 bits (63), Expect = 9.9 Identities = 16/42 (38%), Positives = 20/42 (47%) Frame = +1 Query: 13 PXTTQY*LAASRSKYHPRIHTYVRTYIHQMRSASRCSPLLNL 138 P T QY LAA R + H R + H M S +P+ NL Sbjct: 519 PLTNQYYLAAHRGATYGADHDLARLHPHAMASLRAQTPIPNL 560
>RETST_MOUSE (Q64FW2) All-trans-retinol 13,14-reductase precursor (EC 1.3.99.23)| (All-trans-13,14-dihydroretinol saturase) (RetSat) Length = 609 Score = 28.9 bits (63), Expect = 9.9 Identities = 16/42 (38%), Positives = 20/42 (47%) Frame = +1 Query: 13 PXTTQY*LAASRSKYHPRIHTYVRTYIHQMRSASRCSPLLNL 138 P T QY LAA R + H R + H M S +P+ NL Sbjct: 519 PLTNQYYLAAPRGATYGADHDLARLHPHAMASIRAQTPIPNL 560 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,845,876 Number of Sequences: 219361 Number of extensions: 1289092 Number of successful extensions: 2757 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2707 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2755 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4373119116 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)