ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbags19j23 |
|---|---|
| Clone Library Name | barley_pub |
>RS13_MAIZE (Q05761) 40S ribosomal protein S13| Length = 151 Score = 48.9 bits (115), Expect = 3e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 279 KRTKKLPPTWKYESTTASTLVA 214 KRTKKLPPTWKYESTTASTLVA Sbjct: 130 KRTKKLPPTWKYESTTASTLVA 151
>RS13_SOYBN (P62302) 40S ribosomal protein S13| Length = 151 Score = 45.8 bits (107), Expect = 3e-05 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 279 KRTKKLPPTWKYESTTASTLVA 214 K+TKKLPP WKYESTTASTLVA Sbjct: 130 KKTKKLPPVWKYESTTASTLVA 151
>RS13_PEA (P46298) 40S ribosomal protein S13| Length = 151 Score = 45.8 bits (107), Expect = 3e-05 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 279 KRTKKLPPTWKYESTTASTLVA 214 K+TKKLPP WKYESTTASTLVA Sbjct: 130 KKTKKLPPVWKYESTTASTLVA 151
>RS13B_ARATH (P59224) 40S ribosomal protein S13-2| Length = 151 Score = 45.8 bits (107), Expect = 3e-05 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 279 KRTKKLPPTWKYESTTASTLVA 214 K+TKKLPP WKYESTTASTLVA Sbjct: 130 KKTKKLPPVWKYESTTASTLVA 151
>RS13A_ARATH (P59223) 40S ribosomal protein S13-1| Length = 151 Score = 45.8 bits (107), Expect = 3e-05 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 279 KRTKKLPPTWKYESTTASTLVA 214 K+TKKLPP WKYESTTASTLVA Sbjct: 130 KKTKKLPPVWKYESTTASTLVA 151
>RS13_SCHPO (P28189) 40S ribosomal protein S13| Length = 150 Score = 35.8 bits (81), Expect = 0.029 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -1 Query: 279 KRTKKLPPTWKYESTTASTLVA 214 ++ LPPTWKYES TAS LVA Sbjct: 129 RKVGALPPTWKYESATASALVA 150
>RS13_LUMRU (O77303) 40S ribosomal protein S13| Length = 150 Score = 35.8 bits (81), Expect = 0.029 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -1 Query: 279 KRTKKLPPTWKYESTTASTLVA 214 K K LPP WKYES TAS LVA Sbjct: 129 KTRKVLPPVWKYESATASALVA 150
>RS13_XENLA (P49393) 40S ribosomal protein S13| Length = 150 Score = 35.0 bits (79), Expect = 0.049 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -1 Query: 279 KRTKKLPPTWKYESTTASTLVA 214 K + LPP WKYES+TAS LVA Sbjct: 129 KTRRVLPPNWKYESSTASALVA 150
>RS13_RAT (P62278) 40S ribosomal protein S13| Length = 150 Score = 35.0 bits (79), Expect = 0.049 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -1 Query: 279 KRTKKLPPTWKYESTTASTLVA 214 K + LPP WKYES+TAS LVA Sbjct: 129 KTKRVLPPNWKYESSTASALVA 150
>RS13_MOUSE (P62301) 40S ribosomal protein S13| Length = 150 Score = 35.0 bits (79), Expect = 0.049 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -1 Query: 279 KRTKKLPPTWKYESTTASTLVA 214 K + LPP WKYES+TAS LVA Sbjct: 129 KTKRVLPPNWKYESSTASALVA 150
>RS13_HUMAN (P62277) 40S ribosomal protein S13| Length = 150 Score = 35.0 bits (79), Expect = 0.049 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -1 Query: 279 KRTKKLPPTWKYESTTASTLVA 214 K + LPP WKYES+TAS LVA Sbjct: 129 KTKRVLPPNWKYESSTASALVA 150
>RS13_CRIGR (Q9WVH0) 40S ribosomal protein S13| Length = 150 Score = 35.0 bits (79), Expect = 0.049 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -1 Query: 279 KRTKKLPPTWKYESTTASTLVA 214 K + LPP WKYES+TAS LVA Sbjct: 129 KTKRVLPPNWKYESSTASALVA 150
>RS13_CHICK (Q6ITC7) 40S ribosomal protein S13| Length = 150 Score = 35.0 bits (79), Expect = 0.049 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -1 Query: 279 KRTKKLPPTWKYESTTASTLVA 214 K + LPP WKYES+TAS LVA Sbjct: 129 KTKRVLPPNWKYESSTASALVA 150
>RS13_CAEEL (P51404) 40S ribosomal protein S13| Length = 150 Score = 35.0 bits (79), Expect = 0.049 Identities = 14/22 (63%), Positives = 19/22 (86%) Frame = -1 Query: 279 KRTKKLPPTWKYESTTASTLVA 214 K ++LPPTWKYES TA++LV+ Sbjct: 129 KTKRQLPPTWKYESGTAASLVS 150
>RS13_BOVIN (Q56JX8) 40S ribosomal protein S13| Length = 150 Score = 35.0 bits (79), Expect = 0.049 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -1 Query: 279 KRTKKLPPTWKYESTTASTLVA 214 K + LPP WKYES+TAS LVA Sbjct: 129 KTKRVLPPNWKYESSTASALVA 150
>RS13_SPOFR (Q962R6) 40S ribosomal protein S13| Length = 150 Score = 34.3 bits (77), Expect = 0.084 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -1 Query: 279 KRTKKLPPTWKYESTTASTLVA 214 K LPP WKYES+TAS LVA Sbjct: 129 KTKSVLPPNWKYESSTASALVA 150
>RS13_PLUXY (Q8I7U0) 40S ribosomal protein S13| Length = 150 Score = 34.3 bits (77), Expect = 0.084 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -1 Query: 279 KRTKKLPPTWKYESTTASTLVA 214 K LPP WKYES+TAS LVA Sbjct: 129 KTKSVLPPNWKYESSTASALVA 150
>RS13_DROME (Q03334) 40S ribosomal protein S13| Length = 150 Score = 34.3 bits (77), Expect = 0.084 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -1 Query: 279 KRTKKLPPTWKYESTTASTLVA 214 K LPP WKYES+TAS LVA Sbjct: 129 KTKSVLPPNWKYESSTASALVA 150
>RS13_CHOPR (Q8MUR2) 40S ribosomal protein S13| Length = 150 Score = 34.3 bits (77), Expect = 0.084 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -1 Query: 279 KRTKKLPPTWKYESTTASTLVA 214 K LPP WKYES+TAS LVA Sbjct: 129 KTKSVLPPNWKYESSTASALVA 150
>RS13_MUSDO (P27072) 40S ribosomal protein S13 (Fragment)| Length = 114 Score = 34.3 bits (77), Expect = 0.084 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -1 Query: 279 KRTKKLPPTWKYESTTASTLVA 214 K LPP WKYES+TAS LVA Sbjct: 93 KTKSVLPPNWKYESSTASALVA 114
>RS13_WUCBA (P62300) 40S ribosomal protein S13 (40S ribosomal protein S15)| Length = 150 Score = 33.9 bits (76), Expect = 0.11 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = -1 Query: 279 KRTKKLPPTWKYESTTASTLVA 214 K ++LP TWKYES+TAS LV+ Sbjct: 129 KTKRQLPATWKYESSTASALVS 150
>RS13_BRUPA (P62299) 40S ribosomal protein S13 (17.4K protein)| Length = 150 Score = 33.9 bits (76), Expect = 0.11 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = -1 Query: 279 KRTKKLPPTWKYESTTASTLVA 214 K ++LP TWKYES+TAS LV+ Sbjct: 129 KTKRQLPATWKYESSTASALVS 150
>RS13_ANOGA (P52811) 40S ribosomal protein S13| Length = 150 Score = 33.9 bits (76), Expect = 0.11 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 264 LPPTWKYESTTASTLVA 214 LPP WKYES+TAS LVA Sbjct: 134 LPPNWKYESSTASALVA 150
>RS13_CIOIN (Q8I7D6) 40S ribosomal protein S13| Length = 150 Score = 33.5 bits (75), Expect = 0.14 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = -1 Query: 264 LPPTWKYESTTASTLVA 214 LPP WKYES TAS LVA Sbjct: 134 LPPNWKYESATASALVA 150
>RS13_CANMA (P33192) 40S ribosomal protein S13 (S15)| Length = 150 Score = 33.5 bits (75), Expect = 0.14 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = -1 Query: 264 LPPTWKYESTTASTLVA 214 LPP WKYES TAS LVA Sbjct: 134 LPPNWKYESATASALVA 150
>RS13_AGABI (P78571) 40S ribosomal protein S13| Length = 151 Score = 33.1 bits (74), Expect = 0.19 Identities = 13/22 (59%), Positives = 19/22 (86%) Frame = -1 Query: 279 KRTKKLPPTWKYESTTASTLVA 214 K +++PPT+KY+S TASTL+A Sbjct: 130 KTKQQIPPTFKYDSATASTLIA 151
>RS13_YEAST (P05756) 40S ribosomal protein S13 (S27A) (YS15)| Length = 150 Score = 32.0 bits (71), Expect = 0.42 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -1 Query: 264 LPPTWKYESTTASTLV 217 LPP WKYES TAS LV Sbjct: 134 LPPNWKYESATASALV 149
>RS13_ICTPU (P47772) 40S ribosomal protein S13| Length = 150 Score = 32.0 bits (71), Expect = 0.42 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = -1 Query: 279 KRTKKLPPTWKYESTTASTLVA 214 K + L P WKYES+TAS LVA Sbjct: 129 KTKRVLAPNWKYESSTASALVA 150
>RS13_GILMI (Q9DFR6) 40S ribosomal protein S13| Length = 150 Score = 29.6 bits (65), Expect = 2.1 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = -1 Query: 279 KRTKKLPPTWKYESTTASTLVA 214 K + L P WKY S+TAS LVA Sbjct: 129 KTKRVLAPNWKYXSSTASALVA 150
>ARAQ_BACHD (Q9KEE9) L-arabinose transport system permease protein araQ (EC| 3.6.3.17) Length = 279 Score = 28.1 bits (61), Expect = 6.0 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = -1 Query: 108 TRDQIFYVYSENPINHFWFCSSVWLLLACIHIS 10 T D Y+++E + WF +SVW+ + + +S Sbjct: 57 TLDNFIYIFTEAGLYWTWFGNSVWISIVIVVLS 89
>SOMA2_ACIGU (P26774) Somatotropin-2 (Somatotropin II) (Growth hormone II)| Length = 190 Score = 28.1 bits (61), Expect = 6.0 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 9/44 (20%) Frame = +1 Query: 58 KMVYGILRVNIEN---------LVSCSSKSLQTQKRYIKLMICR 162 K+ Y + VN+ N L+SC K + + Y+K+M CR Sbjct: 138 KLTYDMFDVNLRNNDVLFKNYGLLSCFKKDMHKVETYLKVMKCR 181 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,584,329 Number of Sequences: 219361 Number of extensions: 842077 Number of successful extensions: 2330 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 2282 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2330 length of database: 80,573,946 effective HSP length: 70 effective length of database: 65,218,676 effective search space used: 1565248224 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
