| Clone Name | rbags19j19 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RPOB_AQUPY (Q9X6Y1) DNA-directed RNA polymerase beta chain (EC 2... | 29 | 2.8 | 2 | ABR18_PEA (Q06930) ABA-responsive protein ABR18 | 29 | 3.6 | 3 | APAF_MOUSE (O88879) Apoptotic protease-activating factor 1 (Apaf-1) | 28 | 6.2 |
|---|
>RPOB_AQUPY (Q9X6Y1) DNA-directed RNA polymerase beta chain (EC 2.7.7.6) (RNAP| beta subunit) (Transcriptase beta chain) (RNA polymerase beta subunit) Length = 1469 Score = 29.3 bits (64), Expect = 2.8 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +3 Query: 12 NVFKEKLPSNDSGHILELKLNPMIVNVLRTLPPTYDNLWSSMPP 143 NVF L D + +K+N + N+ + L PT +L ++PP Sbjct: 413 NVFFRDLKRYDLSRVGRVKINAKVHNIPKVLKPTDIDLLDNLPP 456
>ABR18_PEA (Q06930) ABA-responsive protein ABR18| Length = 158 Score = 28.9 bits (63), Expect = 3.6 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +3 Query: 111 TYDN-LWSSMPPPKTNVGKIHPLXXLXPSNVKKIKVRQILEG 233 TY+N S++PP K +H + P V IK +ILEG Sbjct: 5 TYENDTTSTVPPAKLFKAVVHDADLIVPKVVDSIKTVEILEG 46
>APAF_MOUSE (O88879) Apoptotic protease-activating factor 1 (Apaf-1)| Length = 1249 Score = 28.1 bits (61), Expect = 6.2 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +3 Query: 12 NVFKEKLPSNDSGHILELKLNPMIVNVLRTLPPTYDNLWS 131 N+ KE LP+ I E K +P++V+++ L + N W+ Sbjct: 300 NMKKEDLPAEAHSIIKECKGSPLVVSLIGALLRDFPNRWA 339 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,275,531 Number of Sequences: 219361 Number of extensions: 742720 Number of successful extensions: 1750 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1729 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1749 length of database: 80,573,946 effective HSP length: 62 effective length of database: 66,973,564 effective search space used: 1607365536 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)