| Clone Name | rbags19j11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GID_CAUCR (Q9A566) tRNA uridine 5-carboxymethylaminomethyl modif... | 30 | 3.7 | 2 | INHB_DROME (O61643) Inhibin beta chain precursor (Activin beta c... | 29 | 8.3 |
|---|
>GID_CAUCR (Q9A566) tRNA uridine 5-carboxymethylaminomethyl modification| enzyme gid Length = 474 Score = 30.0 bits (66), Expect = 3.7 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = -3 Query: 476 VIGPHLDAGQRPQYTVPPNVWFGSFPTLDVESFASDGSHL-VNSRKRDPEKHYSL 315 + G HL+AG P P N+ +G P L+ DG + + R R ++ SL Sbjct: 409 ITGGHLEAGNGPGSFQPMNINYGLLPPLEAPKVDEDGKKIPLKERGRAKKRLMSL 463
>INHB_DROME (O61643) Inhibin beta chain precursor (Activin beta chain)| Length = 946 Score = 28.9 bits (63), Expect = 8.3 Identities = 19/48 (39%), Positives = 23/48 (47%), Gaps = 14/48 (29%) Frame = -3 Query: 425 PNVWFGSF------PTLDVESFASDGSHLVNSR--------KRDPEKH 324 PN FGS T+ + +FAS GSHL N R +RDP H Sbjct: 413 PNNAFGSSGKNLDQKTIKLRAFASPGSHLFNGRGGRTDQRSERDPSHH 460 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 82,821,148 Number of Sequences: 219361 Number of extensions: 1793359 Number of successful extensions: 4903 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4705 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4902 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3696665728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)