| Clone Name | rbags19j10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y095_TREPA (O83133) Hypothetical protein TP0095 | 29 | 9.6 |
|---|
>Y095_TREPA (O83133) Hypothetical protein TP0095| Length = 648 Score = 29.3 bits (64), Expect = 9.6 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = -2 Query: 249 YRAALFYPPQWMLDPCLLTFAISLLIQNCCLSSTSIYLPRLGMGLK 112 YRAA + P DP L + ++L++ CLS + L LG+ ++ Sbjct: 242 YRAASAFAPH---DPALKWYEAAMLVEMGCLSQAAALLSTLGVSIE 284 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 81,892,416 Number of Sequences: 219361 Number of extensions: 1572696 Number of successful extensions: 3337 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3280 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3337 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5538924943 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)