| Clone Name | rbags19j07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DLGP4_HUMAN (Q9Y2H0) Disks large-associated protein 4 (DAP-4) (S... | 29 | 6.7 | 2 | NYLA_PSES8 (P13398) 6-aminohexanoate-cyclic-dimer hydrolase (EC ... | 28 | 8.7 | 3 | NYLA_FLASK (P13397) 6-aminohexanoate-cyclic-dimer hydrolase (EC ... | 28 | 8.7 | 4 | XDH_EMENI (Q12553) Xanthine dehydrogenase (EC 1.17.1.4) (Purine ... | 24 | 9.9 |
|---|
>DLGP4_HUMAN (Q9Y2H0) Disks large-associated protein 4 (DAP-4)| (SAP90/PSD-95-associated protein 4) (SAPAP4) (PSD-95/SAP90-binding protein 4) Length = 989 Score = 28.9 bits (63), Expect = 6.7 Identities = 26/71 (36%), Positives = 36/71 (50%), Gaps = 3/71 (4%) Frame = -3 Query: 304 KQQGRKGLEEQQRWRRKAPRWWEAGWSPLR--QQRKG*QS-PKARFVSLDSLDRLIPSFS 134 K G + +E + +P+ S LR QQ G QS P+ LDS+D L+PS Sbjct: 371 KAMGDEDSDESGGSPKPSPKTAARRQSYLRATQQSLGEQSNPRRSLDRLDSVDMLLPSKC 430 Query: 133 PSEEKQDMSPV 101 PS E +D +PV Sbjct: 431 PSWE-EDYTPV 440
>NYLA_PSES8 (P13398) 6-aminohexanoate-cyclic-dimer hydrolase (EC 3.5.2.12)| (Nylon oligomers degrading enzyme EI) Length = 492 Score = 28.5 bits (62), Expect = 8.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 283 LEEQQRWRRKAPRWWEAGWSPL 218 ++E + + K RWWEAGW L Sbjct: 362 VDELRYYAGKVERWWEAGWDLL 383
>NYLA_FLASK (P13397) 6-aminohexanoate-cyclic-dimer hydrolase (EC 3.5.2.12)| (Nylon oligomers degrading enzyme EI) Length = 492 Score = 28.5 bits (62), Expect = 8.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 283 LEEQQRWRRKAPRWWEAGWSPL 218 ++E + + K RWWEAGW L Sbjct: 362 VDELRYYAGKVERWWEAGWDLL 383
>XDH_EMENI (Q12553) Xanthine dehydrogenase (EC 1.17.1.4) (Purine hydroxylase| I) Length = 1363 Score = 24.3 bits (51), Expect(2) = 9.9 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +3 Query: 39 VKFKADTEKRPPPKLWRQQ 95 +++K DTE PP LW+ + Sbjct: 242 IEYKPDTELIFPPSLWKHE 260 Score = 22.3 bits (46), Expect(2) = 9.9 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = +2 Query: 98 RHGRHILLFLTRAKRWYKPI 157 +H L F + K+WY+P+ Sbjct: 258 KHELRPLAFGNKRKKWYRPV 277 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,114,230 Number of Sequences: 219361 Number of extensions: 1013277 Number of successful extensions: 2590 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2540 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2589 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)