| Clone Name | rbags19j05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NUD12_MOUSE (Q9DCN1) Peroxisomal NADH pyrophosphatase NUDT12 (EC... | 30 | 4.5 | 2 | TRPM7_MOUSE (Q923J1) Transient receptor potential cation channel... | 29 | 5.9 | 3 | TRPM7_HUMAN (Q96QT4) Transient receptor potential cation channel... | 29 | 7.7 |
|---|
>NUD12_MOUSE (Q9DCN1) Peroxisomal NADH pyrophosphatase NUDT12 (EC 3.6.1.22)| (Nucleoside diphosphate-linked moiety X motif 12) (Nudix motif 12) Length = 462 Score = 29.6 bits (65), Expect = 4.5 Identities = 18/73 (24%), Positives = 34/73 (46%), Gaps = 10/73 (13%) Frame = -1 Query: 486 LCKVNHSDLRQLLLVSKPVSEATVVAKELHFAFATPSKASADGEEEDDG----------P 337 LC++N+ D++ L + ++ + EL +P++A EEE+DG P Sbjct: 176 LCQLNYPDVKGYLAQPEKIT-LVFLGVELEMRKGSPAQAGGVPEEEEDGLVAWFALGIEP 234 Query: 336 GAPKQHRVARSRC 298 GA ++ + C Sbjct: 235 GAAEEFKQRHENC 247
>TRPM7_MOUSE (Q923J1) Transient receptor potential cation channel subfamily M| member 7 (EC 2.7.11.1) (Long transient receptor potential channel 7) (LTrpC7) (Channel-kinase 1) (Transient receptor potential-phospholipase C-interacting kinase) (TRP-PLIK) Length = 1863 Score = 29.3 bits (64), Expect = 5.9 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +2 Query: 14 SYTITYTEIKQRVLFNRSIEEWPYNLHTTNTDDD 115 S + Y+++K FN++IEEW HT + D Sbjct: 57 SLAMKYSDVKLGEHFNQAIEEWSVEKHTEQSPTD 90
>TRPM7_HUMAN (Q96QT4) Transient receptor potential cation channel subfamily M| member 7 (EC 2.7.11.1) (Long transient receptor potential channel 7) (LTrpC7) (Channel-kinase 1) Length = 1865 Score = 28.9 bits (63), Expect = 7.7 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +2 Query: 14 SYTITYTEIKQRVLFNRSIEEWPYNLHTTNTDDD 115 S + Y+++K FN++IEEW HT + D Sbjct: 57 SLAMKYSDVKLGDHFNQAIEEWSVEKHTEQSPTD 90 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,645,421 Number of Sequences: 219361 Number of extensions: 1127662 Number of successful extensions: 3525 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3426 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3525 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3420806017 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)