| Clone Name | rbags19i17 |
|---|---|
| Clone Library Name | barley_pub |
>DNAJ_LACJO (Q74IT7) Chaperone protein dnaJ| Length = 388 Score = 30.0 bits (66), Expect = 4.7 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +3 Query: 411 ISHRLSDVCPLRCNWMKTESRRHPEQCCCCHGNAV 515 I++ S+VCP C+ E HP C CHG+ V Sbjct: 150 ITYTRSEVCPT-CDGSGAEKGTHPITCDKCHGSGV 183
>DEF2_BORPE (Q7VS88) Peptide deformylase 2 (EC 3.5.1.88) (PDF 2) (Polypeptide| deformylase 2) Length = 170 Score = 29.6 bits (65), Expect = 6.1 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +1 Query: 340 PYPFRSMSLIAVC*CKRPGHADGRSVIDYLMSVR 441 PY F + L+AVC H DG+ ++YL +++ Sbjct: 119 PYEFEADGLLAVCVQHEIDHLDGKVFVEYLSNLK 152
>DEF1_BORPA (Q7W1V3) Peptide deformylase 1 (EC 3.5.1.88) (PDF 1) (Polypeptide| deformylase 1) Length = 170 Score = 29.6 bits (65), Expect = 6.1 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +1 Query: 340 PYPFRSMSLIAVC*CKRPGHADGRSVIDYLMSVR 441 PY F + L+AVC H DG+ ++YL +++ Sbjct: 119 PYEFEADGLLAVCVQHEIDHLDGKVFVEYLSNLK 152
>DEF1_BORBR (Q7WQS9) Peptide deformylase 1 (EC 3.5.1.88) (PDF 1) (Polypeptide| deformylase 1) Length = 170 Score = 29.6 bits (65), Expect = 6.1 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +1 Query: 340 PYPFRSMSLIAVC*CKRPGHADGRSVIDYLMSVR 441 PY F + L+AVC H DG+ ++YL +++ Sbjct: 119 PYEFEADGLLAVCVQHEIDHLDGKVFVEYLSNLK 152
>CT165_MOUSE (Q9DA57) Protein C20orf165 homolog| Length = 226 Score = 29.3 bits (64), Expect = 8.0 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 541 AHPEPPGAATALPWQQQH 488 AHPEP GA + W+Q H Sbjct: 188 AHPEPEGAVEGVQWEQAH 205
>CCDC3_MOUSE (Q9D6Y1) Coiled-coil domain-containing protein 3 precursor| Length = 273 Score = 29.3 bits (64), Expect = 8.0 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -3 Query: 538 HPEPPGAATALPWQQQHCSGCLLDSVFIQL 449 HPE PG LPWQ Q G L S +++ Sbjct: 52 HPEVPGLYNYLPWQYQAGEGGLFYSAEVEM 81 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 79,884,376 Number of Sequences: 219361 Number of extensions: 1583226 Number of successful extensions: 3906 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3730 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3900 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4643056080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)