| Clone Name | rbags19h19 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MURC_PROMA (Q7VEJ1) UDP-N-acetylmuramate--L-alanine ligase (EC 6... | 30 | 6.4 | 2 | CARA_HAEDU (Q7VP66) Carbamoyl-phosphate synthase small chain (EC... | 30 | 8.3 |
|---|
>MURC_PROMA (Q7VEJ1) UDP-N-acetylmuramate--L-alanine ligase (EC 6.3.2.8)| (UDP-N-acetylmuramoyl-L-alanine synthetase) Length = 472 Score = 30.0 bits (66), Expect = 6.4 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Frame = +3 Query: 510 RLEKCSIHMNCSFSVRLKSTPNFLNMWLRDLSNLINVRFR--DLLSFLGSRD 659 +L+ C++ N + P F LRDL N+IN++ R DLL F+G+ D Sbjct: 415 KLKSCTLANN-------PNLPIFTCKQLRDLENIINLKTRENDLLLFMGAGD 459
>CARA_HAEDU (Q7VP66) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 389 Score = 29.6 bits (65), Expect = 8.3 Identities = 16/60 (26%), Positives = 25/60 (41%), Gaps = 2/60 (3%) Frame = -1 Query: 620 YIDQVAEVTKPHVEKVRGTLKPYTKRAVHVYGTFLESATTYHRQAQAT--ISDYLHQHEI 447 Y Q+ +T PH+ + ++ G + H +AT +SDYL QH I Sbjct: 51 YAKQIVTLTYPHIGNTGTNDEDNESNQIYASGLIIRDLPLLHSNFRATSSLSDYLIQHNI 110 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 94,566,561 Number of Sequences: 219361 Number of extensions: 2008614 Number of successful extensions: 5699 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5491 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5697 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6314008338 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)