ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbags19g17 |
|---|---|
| Clone Library Name | barley_pub |
>PMYT1_DROME (Q9NI63) Membrane-associated tyrosine- and threonine-specific| cdc2-inhibitory kinase (EC 2.7.11.1) (Myt1 kinase) (dMyt1) Length = 533 Score = 43.1 bits (100), Expect = 4e-04 Identities = 17/34 (50%), Positives = 27/34 (79%) Frame = -3 Query: 487 MQFQSLIKSMMDPDPVRRPSAKEILGHPIFEKLR 386 ++ QS+IKSMM PDP +RP+A+++L HP + L+ Sbjct: 322 LELQSVIKSMMKPDPAQRPTAEQLLSHPKLQYLQ 355
>IRE1_YEAST (P32361) Serine/threonine-protein kinase/endoribonuclease IRE1| precursor (Endoplasmic reticulum-to-nucleus signaling 1) [Includes: Serine/threonine-protein kinase (EC 2.7.11.1); Endoribonuclease (EC 3.1.26.-)] Length = 1115 Score = 35.0 bits (79), Expect = 0.11 Identities = 13/25 (52%), Positives = 20/25 (80%) Frame = -3 Query: 472 LIKSMMDPDPVRRPSAKEILGHPIF 398 LI M+D DP++RP+A ++L HP+F Sbjct: 956 LISQMIDHDPLKRPTAMKVLRHPLF 980
>WEE1_HUMAN (P30291) Wee1-like protein kinase (EC 2.7.10.2) (WEE1hu)| Length = 646 Score = 34.3 bits (77), Expect = 0.18 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = -3 Query: 484 QFQSLIKSMMDPDPVRRPSAKEILGHPIFEKLRNASAKK 368 +F L+K M+ PDP RRPSA ++ H + SA++ Sbjct: 541 EFTELLKVMIHPDPERRPSAMALVKHSVLLSASRKSAEQ 579
>ERN1_MOUSE (Q9EQY0) Serine/threonine-protein kinase/endoribonuclease IRE1| precursor (Inositol-requiring protein 1) (IRE1a) (Ire1-alpha) (Endoplasmic reticulum-to-nucleus signaling 1) [Includes: Serine/threonine-protein kinase (EC 2.7.11.1); Endoribonucle Length = 977 Score = 33.9 bits (76), Expect = 0.24 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = -3 Query: 478 QSLIKSMMDPDPVRRPSAKEILGHPIFEKL 389 + LI+ M+ DP +RPSAK +L HP F L Sbjct: 806 RELIEKMIAMDPQQRPSAKHVLKHPFFWSL 835
>OXSR1_PIG (Q863I2) Serine/threonine-protein kinase OSR1 (EC 2.7.11.1)| (Oxidative stress-responsive 1 protein) Length = 529 Score = 33.9 bits (76), Expect = 0.24 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = -3 Query: 481 FQSLIKSMMDPDPVRRPSAKEILGHPIFEKLRN 383 F+ +I + DP +RP+A E+L H F+K +N Sbjct: 264 FRKMISLCLQKDPEKRPTAAELLRHKFFQKAKN 296
>OXSR1_PONPY (Q5R495) Serine/threonine-protein kinase OSR1 (EC 2.7.11.1)| (Oxidative stress-responsive 1 protein) Length = 527 Score = 33.9 bits (76), Expect = 0.24 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = -3 Query: 481 FQSLIKSMMDPDPVRRPSAKEILGHPIFEKLRN 383 F+ +I + DP +RP+A E+L H F+K +N Sbjct: 264 FRKMISLCLQKDPEKRPTAAELLRHKFFQKAKN 296
>OXSR1_MOUSE (Q6P9R2) Serine/threonine-protein kinase OSR1 (EC 2.7.11.1)| (Oxidative stress-responsive 1 protein) Length = 527 Score = 33.9 bits (76), Expect = 0.24 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = -3 Query: 481 FQSLIKSMMDPDPVRRPSAKEILGHPIFEKLRN 383 F+ +I + DP +RP+A E+L H F+K +N Sbjct: 264 FRKMISLCLQKDPEKRPTAAELLRHKFFQKAKN 296
>OXSR1_HUMAN (O95747) Serine/threonine-protein kinase OSR1 (EC 2.7.11.1)| (Oxidative stress-responsive 1 protein) Length = 527 Score = 33.9 bits (76), Expect = 0.24 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = -3 Query: 481 FQSLIKSMMDPDPVRRPSAKEILGHPIFEKLRN 383 F+ +I + DP +RP+A E+L H F+K +N Sbjct: 264 FRKMISLCLQKDPEKRPTAAELLRHKFFQKAKN 296
>PMYT1_CAEEL (O18209) Membrane-associated tyrosine- and threonine-specific| cdc2-inhibitory kinase (EC 2.7.11.1) (Myt1 kinase) (Lethal protein 37) Length = 677 Score = 33.9 bits (76), Expect = 0.24 Identities = 13/29 (44%), Positives = 22/29 (75%) Frame = -3 Query: 478 QSLIKSMMDPDPVRRPSAKEILGHPIFEK 392 +SLI M+D DP RP+++++L HP+ +K Sbjct: 329 RSLIALMLDSDPRIRPTSRDLLDHPVIKK 357
>YPS7_CAEEL (Q20085) Putative serine/threonine-protein kinase F35H8.7 (EC| 2.7.11.1) Length = 468 Score = 33.5 bits (75), Expect = 0.31 Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = -3 Query: 484 QFQSLIKSMMDPDPVRRPSAKEIL-GHPIFEKLR 386 + + L+K MMD P RRP+ E++ H + EKLR Sbjct: 328 ELRELVKQMMDKAPTRRPTCSELMKNHVVKEKLR 361
>PLK1_CAEEL (P34331) Serine/threonine-protein kinase plk-1 (EC 2.7.11.21)| (Polo-like kinase 1) Length = 649 Score = 33.5 bits (75), Expect = 0.31 Identities = 12/20 (60%), Positives = 18/20 (90%) Frame = -3 Query: 475 SLIKSMMDPDPVRRPSAKEI 416 SLI+ M+DP+P RRP+AK++ Sbjct: 265 SLIRKMLDPEPTRRPTAKQV 284
>ERN1_HUMAN (O75460) Serine/threonine-protein kinase/endoribonuclease IRE1| precursor (Inositol-requiring protein 1) (hIRE1p) (IRE1a) (Ire1-alpha) (Endoplasmic reticulum-to-nucleus signaling 1) [Includes: Serine/threonine-protein kinase (EC 2.7.11.1); Endo Length = 977 Score = 33.1 bits (74), Expect = 0.41 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = -3 Query: 478 QSLIKSMMDPDPVRRPSAKEILGHPIFEKL 389 + LI+ M+ DP +RPSA ++L HP F L Sbjct: 806 RELIEKMIAMDPQKRPSANDVLKHPFFWSL 835
>AL2S2_MOUSE (Q8K4T3) Serine/threonine-protein kinase ALS2CR2 (EC 2.7.11.1)| (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 2 protein homolog) (ILP-interacting protein homolog) (Polyploidy-associated protein kinase) Length = 418 Score = 32.7 bits (73), Expect = 0.53 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = -3 Query: 481 FQSLIKSMMDPDPVRRPSAKEILGHPIFEKLRNAS 377 F SL++ + DP +RPSA +L H F++++ S Sbjct: 342 FFSLVQLCLQQDPEKRPSASSLLSHVFFKQMKEES 376
>AL2S2_HUMAN (Q9C0K7) Serine/threonine-protein kinase ALS2CR2 (EC 2.7.11.1)| (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 2 protein) (ILP-interacting protein) (CALS-21) Length = 418 Score = 32.7 bits (73), Expect = 0.53 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = -3 Query: 481 FQSLIKSMMDPDPVRRPSAKEILGHPIFEKLRNAS 377 F SL++ + DP +RPSA +L H F++++ S Sbjct: 342 FFSLVQLCLQQDPEKRPSASSLLSHVFFKQMKEES 376
>WEE1_MOUSE (P47810) Wee1-like protein kinase (EC 2.7.10.2)| Length = 646 Score = 32.7 bits (73), Expect = 0.53 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = -3 Query: 472 LIKSMMDPDPVRRPSAKEILGHPIFEKLRNASAKK 368 L++ M+ PDP RRPSA E++ H + SA++ Sbjct: 544 LLRVMIHPDPERRPSAMELVKHSVLLSASRKSAEQ 578
>KCCS_MALDO (Q07250) Calcium/calmodulin-dependent serine/threonine-protein| kinase (EC 2.7.11.17) Length = 415 Score = 32.7 bits (73), Expect = 0.53 Identities = 14/27 (51%), Positives = 20/27 (74%) Frame = -3 Query: 484 QFQSLIKSMMDPDPVRRPSAKEILGHP 404 Q + LI S++ DP +RPSA+E+L HP Sbjct: 280 QPKQLISSLLKVDPDKRPSAQELLDHP 306
>NEK9_HUMAN (Q8TD19) Serine/threonine-protein kinase Nek9 (EC 2.7.11.1)| (NimA-related protein kinase 9) (Never in mitosis A-related kinase 9) (Nercc1 kinase) (NIMA-related kinase 8) (Nek8) Length = 979 Score = 32.7 bits (73), Expect = 0.53 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = -3 Query: 487 MQFQSLIKSMMDPDPVRRPSAKEILGHPIFEKLRNASAKK 368 ++ ++ S +D DP +RP+A E+L P+ K R +K Sbjct: 279 LELIQMVHSCLDQDPEQRPTADELLDRPLLRKRRREMEEK 318
>WEE1_DROME (P54350) Wee1-like protein kinase (EC 2.7.10.2) (Dwee1)| Length = 609 Score = 32.3 bits (72), Expect = 0.70 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -3 Query: 481 FQSLIKSMMDPDPVRRPSAKEILGHPIFEKLRNAS 377 F LI MM P P +RP+++ I HPI + + S Sbjct: 490 FNELIAQMMHPYPDKRPTSQSIFSHPILSAVDSKS 524
>STK10_MOUSE (O55098) Serine/threonine-protein kinase 10 (EC 2.7.11.1)| (Lymphocyte-oriented kinase) Length = 966 Score = 31.6 bits (70), Expect = 1.2 Identities = 12/38 (31%), Positives = 23/38 (60%) Frame = -3 Query: 487 MQFQSLIKSMMDPDPVRRPSAKEILGHPIFEKLRNASA 374 ++F+ +K +D +P RPSA ++L HP ++ + A Sbjct: 265 VEFRDFLKIALDKNPETRPSAAQLLQHPFVSRVTSNKA 302
>CDC2_DROME (P23572) Cell division control protein 2 homolog (EC 2.7.11.22) (EC| 2.7.11.23) (p34 protein kinase) Length = 297 Score = 31.6 bits (70), Expect = 1.2 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = -3 Query: 472 LIKSMMDPDPVRRPSAKEILGHPIF 398 LI+ M+ DPV R SAK+IL HP F Sbjct: 263 LIQKMLIYDPVHRISAKDILEHPYF 287
>MHK_ARATH (P43294) Serine/threonine-protein kinase MHK (EC 2.7.11.22)| Length = 443 Score = 31.6 bits (70), Expect = 1.2 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -3 Query: 472 LIKSMMDPDPVRRPSAKEILGHPIFEKLRNAS 377 LI + DP++RP+A E L HP F AS Sbjct: 267 LINRLCSWDPLKRPTADEALNHPFFSMATQAS 298
>WEE1_RAT (Q63802) Wee1-like protein kinase (EC 2.7.10.2)| Length = 646 Score = 31.6 bits (70), Expect = 1.2 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = -3 Query: 484 QFQSLIKSMMDPDPVRRPSAKEILGHPIFEKLRNASAKK 368 + L+K M+ PDP RRPSA ++ H + SA++ Sbjct: 540 ELTELLKVMIHPDPERRPSAMVLVKHSVLLSASRKSAEQ 578
>CDC2H_THEAN (Q26671) Cell division control protein 2 homolog (EC 2.7.11.22) (EC| 2.7.11.23) Length = 298 Score = 31.2 bits (69), Expect = 1.6 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = -3 Query: 472 LIKSMMDPDPVRRPSAKEILGHPIFEKLRNAS 377 LI M+ DPV+R SAKE L H F+ L S Sbjct: 260 LISRMLQLDPVQRISAKEALKHDYFKDLHRPS 291
>STK10_HUMAN (O94804) Serine/threonine-protein kinase 10 (EC 2.7.11.1)| (Lymphocyte-oriented kinase) Length = 968 Score = 31.2 bits (69), Expect = 1.6 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = -3 Query: 487 MQFQSLIKSMMDPDPVRRPSAKEILGHPIFEKLRNASA 374 ++F+ +K +D +P RPSA ++L HP + + A Sbjct: 265 VEFRDFLKIALDKNPETRPSAAQLLEHPFVSSITSNKA 302
>TSSK3_MOUSE (Q9D2E1) Testis-specific serine/threonine-protein kinase 3 (EC| 2.7.11.1) (TSSK-3) (Testis-specific kinase 3) (TSK-3) (Serine/threonine-protein kinase 22C) Length = 268 Score = 30.8 bits (68), Expect = 2.0 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = -3 Query: 478 QSLIKSMMDPDPVRRPSAKEILGHP 404 Q L+K +++PD + RPS +E+ HP Sbjct: 239 QDLLKRLLEPDMILRPSIEEVSWHP 263
>TSSK3_HUMAN (Q96PN8) Testis-specific serine/threonine-protein kinase 3 (EC| 2.7.11.1) (TSSK-3) (Testis-specific kinase 3) (TSK-3) (Serine/threonine-protein kinase 22C) Length = 268 Score = 30.8 bits (68), Expect = 2.0 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = -3 Query: 478 QSLIKSMMDPDPVRRPSAKEILGHP 404 Q L+K +++PD + RPS +E+ HP Sbjct: 239 QDLLKRLLEPDMILRPSIEEVSWHP 263
>CCAMK_PEA (Q6RET6) Calcium and calcium/calmodulin-dependent| serine/threonine-protein kinase (EC 2.7.11.17) (PsCCaMK) (Ps-SYM9) (Fragment) Length = 527 Score = 30.8 bits (68), Expect = 2.0 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = -3 Query: 478 QSLIKSMMDPDPVRRPSAKEILGHP 404 ++LI S++ DP +RPSA+E+L P Sbjct: 288 KNLISSLLTVDPAKRPSAQELLSDP 312
>E2AK3_RAT (Q9Z1Z1) Eukaryotic translation initiation factor 2-alpha kinase 3| precursor (EC 2.7.11.1) (PRKR-like endoplasmic reticulum kinase) (Pancreatic eIF2-alpha kinase) Length = 1108 Score = 30.8 bits (68), Expect = 2.0 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -3 Query: 484 QFQSLIKSMMDPDPVRRPSAKEILGHPIFEKL 389 Q +++ M+ P P+ RP A +I+ + +FE L Sbjct: 1041 QEHMMVQDMLSPSPMERPEATDIIENAVFENL 1072
>E2AK3_MOUSE (Q9Z2B5) Eukaryotic translation initiation factor 2-alpha kinase 3| precursor (EC 2.7.11.1) (PRKR-like endoplasmic reticulum kinase) (Pancreatic eIF2-alpha kinase) Length = 1114 Score = 30.8 bits (68), Expect = 2.0 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -3 Query: 484 QFQSLIKSMMDPDPVRRPSAKEILGHPIFEKL 389 Q +++ M+ P P RP A +I+ + IFE L Sbjct: 1047 QEHMMVQDMLSPSPTERPEATDIIENAIFENL 1078
>CLK1_HUMAN (P49759) Dual specificity protein kinase CLK1 (EC 2.7.12.1)| (CDC-like kinase 1) Length = 484 Score = 30.8 bits (68), Expect = 2.0 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = -3 Query: 472 LIKSMMDPDPVRRPSAKEILGHPIFEKLRNA 380 LI+ M++ DP +R + +E L HP F+ L+ + Sbjct: 453 LIQKMLEYDPAKRITLREALKHPFFDLLKKS 483
>CRK1_SCHPO (Q12126) Serine/threonine-protein kinase crk1 (EC 2.7.11.23)| (Mitotic catastrophe suppressor 6) Length = 335 Score = 30.4 bits (67), Expect = 2.7 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -3 Query: 472 LIKSMMDPDPVRRPSAKEILGHPIFEKL 389 L+K M+D +P RRP+A++ L H F L Sbjct: 268 LLKMMLDYNPYRRPTAQQALEHHYFSAL 295
>CCAMK_LILLO (Q43531) Calcium and calcium/calmodulin-dependent| serine/threonine-protein kinase (EC 2.7.11.17) (LlCCaMK) Length = 520 Score = 30.4 bits (67), Expect = 2.7 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = -3 Query: 478 QSLIKSMMDPDPVRRPSAKEILGHP 404 + LI S++ DP +RP+A ++L HP Sbjct: 276 KDLISSLLSVDPYKRPTANDLLKHP 300
>CDK2_RAT (Q63699) Cell division protein kinase 2 (EC 2.7.11.22)| Length = 298 Score = 30.0 bits (66), Expect = 3.5 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -3 Query: 478 QSLIKSMMDPDPVRRPSAKEILGHPIFE 395 +SL+ M+ DP +R SAK L HP F+ Sbjct: 260 RSLLSQMLHYDPNKRISAKAALAHPFFQ 287
>CDK2_MESAU (P48963) Cell division protein kinase 2 (EC 2.7.11.22)| Length = 298 Score = 30.0 bits (66), Expect = 3.5 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -3 Query: 478 QSLIKSMMDPDPVRRPSAKEILGHPIFE 395 +SL+ M+ DP +R SAK L HP F+ Sbjct: 260 RSLLSQMLHYDPNKRISAKAALAHPFFQ 287
>CDK2_HUMAN (P24941) Cell division protein kinase 2 (EC 2.7.11.22) (p33 protein| kinase) Length = 298 Score = 30.0 bits (66), Expect = 3.5 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -3 Query: 478 QSLIKSMMDPDPVRRPSAKEILGHPIFE 395 +SL+ M+ DP +R SAK L HP F+ Sbjct: 260 RSLLSQMLHYDPNKRISAKAALAHPFFQ 287
>CDK2_CRIGR (O55076) Cell division protein kinase 2 (EC 2.7.11.22)| Length = 298 Score = 30.0 bits (66), Expect = 3.5 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -3 Query: 478 QSLIKSMMDPDPVRRPSAKEILGHPIFE 395 +SL+ M+ DP +R SAK L HP F+ Sbjct: 260 RSLLSQMLHYDPNKRISAKAALAHPFFQ 287
>CDK2_BOVIN (Q5E9Y0) Cell division protein kinase 2 (EC 2.7.11.22)| Length = 298 Score = 30.0 bits (66), Expect = 3.5 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -3 Query: 478 QSLIKSMMDPDPVRRPSAKEILGHPIFE 395 +SL+ M+ DP +R SAK L HP F+ Sbjct: 260 RSLLSQMLHYDPNKRISAKAALAHPFFQ 287
>CDC2H_THEPA (Q27032) Cell division control protein 2 homolog (EC 2.7.11.22) (EC| 2.7.11.23) Length = 298 Score = 30.0 bits (66), Expect = 3.5 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -3 Query: 472 LIKSMMDPDPVRRPSAKEILGHPIFEKL 389 LI M+ DPV+R SAKE L H F+ L Sbjct: 260 LISRMLQLDPVQRISAKEALKHDYFKDL 287
>CLK4_MOUSE (O35493) Dual specificity protein kinase CLK4 (EC 2.7.12.1)| (CDC-like kinase 4) Length = 481 Score = 30.0 bits (66), Expect = 3.5 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -3 Query: 472 LIKSMMDPDPVRRPSAKEILGHPIFEKLR 386 L++ M++ DP RR + E L HP F+ L+ Sbjct: 451 LVRRMLEYDPARRITLDEALQHPFFDLLK 479
>CDK2_MOUSE (P97377) Cell division protein kinase 2 (EC 2.7.11.22)| Length = 346 Score = 30.0 bits (66), Expect = 3.5 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -3 Query: 478 QSLIKSMMDPDPVRRPSAKEILGHPIFE 395 +SL+ M+ DP +R SAK L HP F+ Sbjct: 308 RSLLSQMLHYDPNKRISAKAALAHPFFQ 335
>CDKL1_HUMAN (Q00532) Cyclin-dependent kinase-like 1 (EC 2.7.11.22)| (Serine/threonine-protein kinase KKIALRE) (Protein kinase p42 KKIALRE) Length = 357 Score = 29.6 bits (65), Expect = 4.5 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = -3 Query: 472 LIKSMMDPDPVRRPSAKEILGHPIFEKLR 386 L+K + DP +R + +++L HP FE +R Sbjct: 263 LLKGCLHMDPTQRLTCEQLLHHPYFENIR 291
>STK39_MOUSE (Q9Z1W9) STE20/SPS1-related proline-alanine-rich protein kinase (EC| 2.7.11.1) (Ste-20-related kinase) (Serine/threonine-protein kinase 39) Length = 556 Score = 29.6 bits (65), Expect = 4.5 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -3 Query: 481 FQSLIKSMMDPDPVRRPSAKEILGHPIFEKLRN 383 F+ L+ + DP +RP+A E+L F+K +N Sbjct: 322 FRKLLSLCLQKDPSKRPTAAELLKCKFFQKAKN 354
>STK39_HUMAN (Q9UEW8) STE20/SPS1-related proline-alanine-rich protein kinase (EC| 2.7.11.1) (Ste-20-related kinase) (Serine/threonine-protein kinase 39) (DCHT) Length = 547 Score = 29.6 bits (65), Expect = 4.5 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -3 Query: 481 FQSLIKSMMDPDPVRRPSAKEILGHPIFEKLRN 383 F+ L+ + DP +RP+A E+L F+K +N Sbjct: 312 FRKLLSLCLQKDPSKRPTAAELLKCKFFQKAKN 344
>STK39_RAT (O88506) STE20/SPS1-related proline-alanine-rich protein kinase (EC| 2.7.11.1) (Ste-20-related kinase) (Serine/threonine-protein kinase 39) (Pancreatic serine/threonine-protein kinase) (PS/TK) (PSTK1) Length = 553 Score = 29.6 bits (65), Expect = 4.5 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -3 Query: 481 FQSLIKSMMDPDPVRRPSAKEILGHPIFEKLRN 383 F+ L+ + DP +RP+A E+L F+K +N Sbjct: 319 FRKLLSLCLQKDPSKRPTAAELLKCKFFQKAKN 351
>MNB_DROME (P49657) Serine/threonine-protein kinase minibrain (EC 2.7.12.1)| Length = 908 Score = 29.6 bits (65), Expect = 4.5 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +3 Query: 12 GHHNPSFSSSHTTITTPDGSQADCPQ 89 GHHN S++H +I+ P + D PQ Sbjct: 680 GHHNSGSSNNHNSISYPHAMECDPPQ 705
>CDC2D_ANTMA (Q38775) Cell division control protein 2 homolog D (EC 2.7.11.22)| (EC 2.7.11.23) Length = 312 Score = 29.3 bits (64), Expect = 5.9 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = -3 Query: 475 SLIKSMMDPDPVRRPSAKEILGHPIFEKL 389 +L+ M+ +P RR SAK+ + HP F++L Sbjct: 279 NLLSEMLHYEPSRRISAKKAMEHPYFDEL 307
>MK12_RAT (Q63538) Mitogen-activated protein kinase 12 (EC 2.7.11.24)| (Extracellular signal-regulated kinase 6) (ERK-6) (Stress-activated protein kinase 3) (Mitogen-activated protein kinase p38 gamma) (MAP kinase p38 gamma) Length = 367 Score = 29.3 bits (64), Expect = 5.9 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = -3 Query: 484 QFQSLIKSMMDPDPVRRPSAKEILGHPIFEKLRN 383 Q +L++ M+ D +R +A E L HP FE LR+ Sbjct: 283 QAVNLLEKMLVLDAEQRVTAAEALAHPYFESLRD 316
>DOA_DROME (P49762) Serine/threonine-protein kinase Doa (EC 2.7.12.1) (Protein| darkener of apricot) Length = 832 Score = 29.3 bits (64), Expect = 5.9 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = -3 Query: 475 SLIKSMMDPDPVRRPSAKEILGHPIFEKL 389 SLIK M++ +P R + E L HP F++L Sbjct: 774 SLIKKMLEYEPSSRITLGEALHHPFFDRL 802
>CDC2_AJECA (P54119) Cell division control protein 2 (EC 2.7.11.22) (EC| 2.7.11.23) (Cyclin-dependent protein kinase) Length = 324 Score = 29.3 bits (64), Expect = 5.9 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = -3 Query: 472 LIKSMMDPDPVRRPSAKEILGHPIFE 395 L+ +M++ DP RR SAK+ HP F+ Sbjct: 283 LLDAMLEYDPARRISAKQACMHPYFQ 308
>GCN2_ARATH (Q9LX30) Probable serine/threonine-protein kinase GCN2 (EC| 2.7.11.1) Length = 1241 Score = 29.3 bits (64), Expect = 5.9 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -3 Query: 475 SLIKSMMDPDPVRRPSAKEILGH 407 SL++ +M P P RPSA E+L H Sbjct: 706 SLLRRLMSPSPSDRPSATELLKH 728
>CDKL1_BRARE (Q6AXJ9) Cyclin-dependent kinase-like 1 (EC 2.7.11.22)| Length = 350 Score = 29.3 bits (64), Expect = 5.9 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = -3 Query: 484 QFQSLIKSMMDPDPVRRPSAKEILGHPIFEKLRNAS 377 Q SL+K + DP R S +++L P F+ LR S Sbjct: 259 QALSLMKGCLRMDPAERLSCEQLLEQPYFDSLREES 294
>GSK31_SCHPO (Q9URT9) Protein kinase gsk31 (EC 2.7.11.1)| Length = 381 Score = 28.9 bits (63), Expect = 7.7 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = -3 Query: 472 LIKSMMDPDPVRRPSAKEILGHPIFEKLRN 383 L+ M+ P +R SA E+L HP F++LR+ Sbjct: 285 LLHKMLTYVPSKRISAIEVLTHPFFDELRD 314
>HUNK_PANTR (Q68UT7) Hormonally up-regulated neu tumor-associated kinase (EC| 2.7.11.1) Length = 714 Score = 28.9 bits (63), Expect = 7.7 Identities = 9/23 (39%), Positives = 19/23 (82%) Frame = -3 Query: 475 SLIKSMMDPDPVRRPSAKEILGH 407 S ++S+++PDPV+RP+ ++ L + Sbjct: 295 SFLRSLLEPDPVKRPNIQQALAN 317
>HUNK_HUMAN (P57058) Hormonally up-regulated neu tumor-associated kinase (EC| 2.7.11.1) (Serine/threonine-protein kinase MAK-V) (B19) Length = 714 Score = 28.9 bits (63), Expect = 7.7 Identities = 9/23 (39%), Positives = 19/23 (82%) Frame = -3 Query: 475 SLIKSMMDPDPVRRPSAKEILGH 407 S ++S+++PDPV+RP+ ++ L + Sbjct: 295 SFLRSLLEPDPVKRPNIQQALAN 317
>NRBP_PONPY (Q5RBH9) Nuclear receptor-binding protein| Length = 535 Score = 28.9 bits (63), Expect = 7.7 Identities = 12/29 (41%), Positives = 20/29 (68%), Gaps = 1/29 (3%) Frame = -3 Query: 478 QSLIKSMMDPDPVRRPSAKEILGHP-IFE 395 + I+ + +P RRP+A+E+L HP +FE Sbjct: 301 REFIQKCLQSEPARRPTARELLFHPALFE 329
>NRBP_MOUSE (Q99J45) Nuclear receptor-binding protein (MLF1 adapter molecule)| (HLS7-interacting protein kinase) Length = 535 Score = 28.9 bits (63), Expect = 7.7 Identities = 12/29 (41%), Positives = 20/29 (68%), Gaps = 1/29 (3%) Frame = -3 Query: 478 QSLIKSMMDPDPVRRPSAKEILGHP-IFE 395 + I+ + +P RRP+A+E+L HP +FE Sbjct: 301 REFIQKCLQSEPARRPTARELLFHPALFE 329
>NRBP_MACFA (Q4R8X0) Nuclear receptor-binding protein| Length = 535 Score = 28.9 bits (63), Expect = 7.7 Identities = 12/29 (41%), Positives = 20/29 (68%), Gaps = 1/29 (3%) Frame = -3 Query: 478 QSLIKSMMDPDPVRRPSAKEILGHP-IFE 395 + I+ + +P RRP+A+E+L HP +FE Sbjct: 301 REFIQKCLQSEPARRPTARELLFHPALFE 329
>NRBP_HUMAN (Q9UHY1) Nuclear receptor-binding protein| Length = 535 Score = 28.9 bits (63), Expect = 7.7 Identities = 12/29 (41%), Positives = 20/29 (68%), Gaps = 1/29 (3%) Frame = -3 Query: 478 QSLIKSMMDPDPVRRPSAKEILGHP-IFE 395 + I+ + +P RRP+A+E+L HP +FE Sbjct: 301 REFIQKCLQSEPARRPTARELLFHPALFE 329
>MDCB_KLEPN (P71422) 2-(5''-triphosphoribosyl)-3'-dephosphocoenzyme-A synthase| (EC 2.7.8.25) (2-(5''-triphosphoribosyl)-3'-dephospho-CoA synthase) Length = 280 Score = 28.9 bits (63), Expect = 7.7 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = +1 Query: 334 LARSPTSGYDPTSLPTHYEASRRWGVPGS 420 LAR P G+ P S ASRRW VPG+ Sbjct: 138 LARLP-DGFAPKSFSKGLRASRRWQVPGA 165
>MAK_RAT (P20793) Serine/threonine-protein kinase MAK (EC 2.7.11.22) (Male| germ cell-associated kinase) Length = 622 Score = 28.9 bits (63), Expect = 7.7 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -3 Query: 472 LIKSMMDPDPVRRPSAKEILGHPIFE 395 L+ M++ DP +RP+A + L HP F+ Sbjct: 260 LMTEMLNWDPKKRPTASQALKHPYFQ 285
>MAK_MOUSE (Q04859) Serine/threonine-protein kinase MAK (EC 2.7.11.22) (Male| germ cell-associated kinase) (Protein kinase RCK) Length = 622 Score = 28.9 bits (63), Expect = 7.7 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -3 Query: 472 LIKSMMDPDPVRRPSAKEILGHPIFE 395 L+ M++ DP +RP+A + L HP F+ Sbjct: 260 LMTEMLNWDPKKRPTASQALKHPYFQ 285
>YS89_CAEEL (Q09624) Hypothetical protein ZK945.9| Length = 3178 Score = 28.9 bits (63), Expect = 7.7 Identities = 19/69 (27%), Positives = 30/69 (43%) Frame = +3 Query: 27 SFSSSHTTITTPDGSQADCPQHH*HTSKPGKPTTTGAISP*LQNIGRLPSAXMAFTA*QP 206 S SSS TT+TTP +++ ++ P TT +P G S+ + Sbjct: 464 SSSSSSTTVTTPTSTEST-------STSPSSTVTTSTTAPSTSTTGPSSSSSTPSSTASS 516 Query: 207 SISSYTETT 233 S+SS +T Sbjct: 517 SVSSTASST 525
>SECY_PEA (Q9XQU4) Preprotein translocase secY subunit, chloroplast precursor| (CpSecY) Length = 527 Score = 28.9 bits (63), Expect = 7.7 Identities = 17/78 (21%), Positives = 37/78 (47%) Frame = +1 Query: 217 AIQKQQIRAKN*SVPRFRRAFFQTDKI*QQLMSCSLAWLLARSPTSGYDPTSLPTHYEAS 396 ++ ++ I K+ PR R+ F+ + +L S S + L + +DP + +S Sbjct: 16 SLNRRLIPTKHNLSPRLLRSSFRQHNLSLRLRSSSSSNLYTSCDLANFDPLGINPDLSSS 75 Query: 397 RRWGVPGSLLQTAASRDQ 450 W ++ QT++ +D+ Sbjct: 76 STWRNLLTIFQTSSQKDK 93
>MAK_HUMAN (P20794) Serine/threonine-protein kinase MAK (EC 2.7.11.22) (Male| germ cell-associated kinase) Length = 623 Score = 28.9 bits (63), Expect = 7.7 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -3 Query: 472 LIKSMMDPDPVRRPSAKEILGHPIFE 395 L+ M++ DP +RP+A + L HP F+ Sbjct: 260 LMTEMLNWDPKKRPTASQALKHPYFQ 285
>LIN2_CAEEL (P54936) Protein lin-2 (Abnormal cell lineage protein 2)| Length = 961 Score = 28.9 bits (63), Expect = 7.7 Identities = 16/37 (43%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Frame = -3 Query: 478 QSLIKSMMDPDPVRRPSAKEILGHP-IFEKLRNASAK 371 ++L++ M++ DP +R SAKE L H I +K AS K Sbjct: 255 RNLVRRMLNADPSKRISAKEALNHEWIRDKEHMASRK 291
>NEK9_XENLA (Q7ZZC8) Serine/threonine-protein kinase Nek9 (EC 2.7.11.1)| (NimA-related protein kinase 9) (XNek9) (Nercc1 kinase) Length = 944 Score = 28.9 bits (63), Expect = 7.7 Identities = 16/58 (27%), Positives = 30/58 (51%) Frame = -3 Query: 472 LIKSMMDPDPVRRPSAKEILGHPIFEKLRNASAKK*GHILK*ESGQAAKRGSTTSAAV 299 ++ + ++ DP +RP+A EIL PI R +K + + S + + G+ T A + Sbjct: 266 VVHACLEQDPEKRPTADEILERPILSWRRRDMEEKVSMLNR--SNKKPRTGTVTEAPI 321
>MK13_RAT (Q9WTY9) Mitogen-activated protein kinase 13 (EC 2.7.11.24)| (Stress-activated protein kinase 4) (Mitogen-activated protein kinase p38 delta) (MAP kinase p38 delta) Length = 366 Score = 28.9 bits (63), Expect = 7.7 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = -3 Query: 484 QFQSLIKSMMDPDPVRRPSAKEILGHPIFEKLRN 383 Q L+ M++ D +R +A + L HP+FE LR+ Sbjct: 280 QAVDLLDKMLELDVDKRLTAAQALAHPLFEPLRD 313
>CDC2_EMENI (Q00646) Cell division control protein 2 (EC 2.7.11.22) (EC| 2.7.11.23) (Cyclin-dependent protein kinase) Length = 323 Score = 28.9 bits (63), Expect = 7.7 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = -3 Query: 472 LIKSMMDPDPVRRPSAKEILGHPIFE 395 L++++++ DP RR SAK+ HP F+ Sbjct: 282 LLEALLEYDPARRISAKQACMHPYFQ 307 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 78,306,485 Number of Sequences: 219361 Number of extensions: 1684072 Number of successful extensions: 5308 Number of sequences better than 10.0: 68 Number of HSP's better than 10.0 without gapping: 4994 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5293 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3420806017 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
