| Clone Name | rbags19g13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RPS2_ARATH (Q42484) Disease resistance protein RPS2 (Resistance ... | 30 | 5.3 | 2 | CMLE_NEUCR (P38677) Carboxy-cis,cis-muconate cyclase (EC 5.5.1.5... | 30 | 6.9 |
|---|
>RPS2_ARATH (Q42484) Disease resistance protein RPS2 (Resistance to Pseudomonas| syringae protein 2) Length = 909 Score = 30.4 bits (67), Expect = 5.3 Identities = 18/58 (31%), Positives = 33/58 (56%), Gaps = 4/58 (6%) Frame = +3 Query: 384 ESCIKHFVGYGPVSSSLKLNTFLKGFLLI----LQSMLKFEAVK*EVKQYFLIKGFTL 545 E ++++VG G ++SS +NT KG+ LI +L+ K +VK + +++ F L Sbjct: 423 EQLVEYWVGEGFLTSSHGVNTIYKGYFLIGDLKAACLLETGDEKTQVKMHNVVRSFAL 480
>CMLE_NEUCR (P38677) Carboxy-cis,cis-muconate cyclase (EC 5.5.1.5)| (3-carboxy-cis,cis-muconate lactonizing enzyme) (CMLE) Length = 365 Score = 30.0 bits (66), Expect = 6.9 Identities = 29/119 (24%), Positives = 48/119 (40%), Gaps = 8/119 (6%) Frame = -1 Query: 688 TSTIFVDIAGLP--VSYENYYNSFEARGG--TVDEVMNSFIQLPKFESNMNSNVKPFI-- 527 T IF+ A P Y N + F G +V E + +E N+ + + Sbjct: 94 TRAIFLLAAKQPPYAVYANPFYKFAGYGNVFSVSETGKLEKNVQNYEYQENTGIHGMVFD 153 Query: 526 --KKYCFTSYFTASNFNMLCKISKKPFKNVFSFKLEDTGPYPTKCLMHDSGHYLPVYME 356 + Y +++ TA+ K++ + V S D G +P MH +G+YL ME Sbjct: 154 PTETYLYSADLTANKLWTHRKLASGEVELVGSVDAPDPGDHPRWVAMHPTGNYLYALME 212 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 84,761,677 Number of Sequences: 219361 Number of extensions: 1602855 Number of successful extensions: 3831 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3754 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3830 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6825954960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)